Property Summary

NCBI Gene PubMed Count 62
PubMed Score 118.10
PubTator Score 86.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.72453602230125E-14
ulcerative colitis 2087 1.30481613553836E-8
psoriasis 6685 3.32378728212402E-7
group 3 medulloblastoma 2254 1.17441580912595E-6
atypical teratoid / rhabdoid tumor 4369 3.19403729542928E-6
ovarian cancer 8492 8.2837369860473E-4
pancreatic cancer 2300 0.00174400961068829
primitive neuroectodermal tumor 3031 0.00199673040218482
subependymal giant cell astrocytoma 2287 0.00245021908125658
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00254427521449736
primary pancreatic ductal adenocarcinoma 1271 0.0028988229686691
gastric carcinoma 832 0.00979094741675716
invasive ductal carcinoma 2950 0.0166911096019091
active Crohn's disease 918 0.0169562227426657

Expression

Synonym

Accession O95865 A2BEZ7 DDAH-2
Symbols G6a
DDAH
NG30
DDAHII
HEL-S-277

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (43)

PMID Text
26515557 expression of DDAH2 is associated with invasiveness of lung adenocarcinoma via tumor angiogenesis
26082478 Inhibiting the expression of DDAH1, but not DDAH2, resulted in a significant increase in the sensitivity of the EVT cell line SGHPL-4 to tumour necrosis factor related apoptosis inducing ligand (TRAIL) induced apoptosis
25701782 The percentage of senescent endothelial progenitor cells increased while the expression of DDAH2 decreased concomitantly with an increase in the plasma levels of asymmetric dimethylarginine in patients with type 2 diabetes mellitus.
25236572 Our results suggest that the rs805304 C allele of the DDAH gene was associated with decreased risk of myocardial infarction and decreased risk of obesity.
25194333 increased ADMA levels in rheumatoid arthritis do not appear to relate to DDAH genetic polymorphisms
25152204 DDAH-1 is a specific molecular target for portal pressure reduction, through actions on ADMA-mediated regulation of eNOS activity.
24934151 Homocysteine disrupts EPCs function via inducing the hypermethylation of DDAH2 promoter, suggesting a key role of epigenetic mechanism in the progression of atherosclerosis
24928011 -476 to -469 of the DDAH2 promoter was a NF-kB responsive element and is important for the transactivation of DDAH2.
24155659 Our approaches revealed signature candidates of differentially hypermethylated genes of DDAH2 and DUSP1 which can be further developed as potential biomarkers for OSCC as diagnostic, prognostic and therapeutic targets in the future.
24134589 Enhancing pulmonary DDAH II activity attenuates LPS-mediated lung leak in acute lung injury.
More...

AA Sequence

MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLP      1 - 70
LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGL     71 - 140
SKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASL    141 - 210
TLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLS    211 - 280
TRPHS                                                                     281 - 285
//

Text Mined References (64)

PMID Year Title
26515557 2016 Dimethylarginine dimethylaminohydrolase 2 promotes tumor angiogenesis in lung adenocarcinoma.
26082478 2015 Inhibition of DDAH1, but not DDAH2, results in apoptosis of a human trophoblast cell line in response to TRAIL.
25701782 2015 Accelerated onset of senescence of endothelial progenitor cells in patients with type 2 diabetes mellitus: role of dimethylarginine dimethylaminohydrolase 2 and asymmetric dimethylarginine.
25236572 2014 Protective role of DDAH2 (rs805304) gene polymorphism in patients with myocardial infarction.
25194333 2014 Relationship between dimethylarginine dimethylaminohydrolase gene variants and asymmetric dimethylarginine in patients with rheumatoid arthritis.
25152204 2015 Hepatic dimethylarginine-dimethylaminohydrolase1 is reduced in cirrhosis and is a target for therapy in portal hypertension.
24934151 2014 Hypermethylation of DDAH2 promoter contributes to the dysfunction of endothelial progenitor cells in coronary artery disease patients.
24928011 2014 [Identification of a NFB responsive element within the dimethylarginine dimethylaminohydrolase 2 gene promoter].
24895913 2014 miR-21/DDAH1 pathway regulates pulmonary vascular responses to hypoxia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...