Property Summary

NCBI Gene PubMed Count 129
Grant Count 37
R01 Count 13
Funding $3,251,355.91
PubMed Score 326.05
PubTator Score 305.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
astrocytic glioma 1.500 0.002
ependymoma 1.500 0.009
oligodendroglioma 1.900 0.001
psoriasis -3.400 0.000
Hydrolethalus syndrome -1.110 0.022
breast carcinoma 1.100 0.000
Breast cancer 3.700 0.000
pituitary cancer 1.400 0.000

Gene RIF (113)

PMID Text
27004414 Single nucleotide polymorphisms in FADS gene (particularly rs174537) associate with plasma fatty acids and desaturase levels in patients with both type 2 diabetes and coronary artery disease.
26609056 We investigated the association of surgery-induced weight loss and FA desaturase (FADS)1/2 genotypes with serum and AT FA profile and with AT inflammation, measured as interleukin (IL)-1beta and NFkappaB pathway gene expression.
26513616 No associations were observed between any single-nucleotide polymorphisms and major depressive disorder diagnosis or attempted suicide status.
26474818 genetic association study in population of pregnant women in Republic of Seychelles: SNPs in FADS1/FADS2 are associated with maternal arachidonic acid status; a subtle association exists with neurodevelopment in this high fish-eating population. [REVIEW]
26455892 FADS2 has been shown to be important in the metabolism of polyunsaturated fatty acids.
26439440 FADS2 has been shown to be important in the metabolism of polyunsaturated fatty acids.
26277395 The enzyme C440A is also able to catalyse hydrolysis of FAD bound to the PAPS reductase domain, which is quantitatively converted into FMN.
26261632 Suggest that the FADS1 rs174546 SNP and the FADS2 rs174601 SNP are associated with the risk of coronary artery disease and ischemic stroke, and are likely to influence serum lipid levels.
26078250 fatty acid desaturase 2 index was associated with child cognitive function in Indonesia
26065859 results demonstrate that the FADS2 classical transcript mediates direct Delta4 desaturation to yield 22:6n-3 and 22:5n-6 in human cells
More...

AA Sequence

MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATD      1 - 70
AFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHI     71 - 140
IALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASA    141 - 210
NWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQ    211 - 280
YQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQE    281 - 350
AYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL    351 - 420
RALLDIIRSLKKSGKLWLDAYLHK                                                  421 - 444
//

Text Mined References (134)

PMID Year Title
27004414 2016 Polymorphisms in FADS1 and FADS2 alter plasma fatty acids and desaturase levels in type 2 diabetic patients with coronary artery disease.
26609056 2016 FADS2 genotype regulates delta-6 desaturase activity and inflammation in human adipose tissue.
26513616 2016 Lack of association of SNPs from the FADS1-FADS2 gene cluster with major depression or suicidal behavior.
26474818 2015 Genetic variation in FADS genes is associated with maternal long-chain PUFA status but not with cognitive development of infants in a high fish-eating observational study.
26455892 2015 Genetic and epigenetic transgenerational implications related to omega-3 fatty acids. Part II: maternal FADS2 rs174575 genotype and DNA methylation predict toddler cognitive performance.
26439440 2015 Genetic and epigenetic transgenerational implications related to omega-3 fatty acids. Part I: maternal FADS2 genotype and DNA methylation correlate with polyunsaturated fatty acid status in toddlers: an exploratory analysis.
26277395 2015 Human FAD synthase is a bi-functional enzyme with a FAD hydrolase activity in the molybdopterin binding domain.
26261632 2015 Association of two polymorphisms in the FADS1/FADS2 gene cluster and the risk of coronary artery disease and ischemic stroke.
26078250 2015 Genetic variants of FADS gene cluster, plasma LC-PUFA levels and the association with cognitive function of under-two-year-old Sasaknese Indonesian children.
26065859 2015 The fatty acid desaturase 2 (FADS2) gene product catalyzes ?4 desaturation to yield n-3 docosahexaenoic acid and n-6 docosapentaenoic acid in human cells.
More...