Property Summary

NCBI Gene PubMed Count 140
PubMed Score 349.59
PubTator Score 305.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.500 2.2e-03
Breast cancer 1.200 2.7e-05
breast carcinoma 1.100 9.9e-12
ependymoma 1.500 9.1e-03
Hydrolethalus syndrome -1.110 2.2e-02
malignant mesothelioma 2.100 3.0e-07
oligodendroglioma 1.900 1.2e-03
pituitary cancer 1.400 7.7e-08
psoriasis -2.100 8.2e-04

Gene RIF (124)

AA Sequence

MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATD      1 - 70
AFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHI     71 - 140
IALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASA    141 - 210
NWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQ    211 - 280
YQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQE    281 - 350
AYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL    351 - 420
RALLDIIRSLKKSGKLWLDAYLHK                                                  421 - 444
//

Text Mined References (145)

PMID Year Title