Property Summary

NCBI Gene PubMed Count 321
Grant Count 396
R01 Count 216
Funding $42,059,519.09
PubMed Score 1522.57
PubTator Score 1817.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95863 B2R842 Q9P113 Q9UBP7 Q9UHH7
Symbols SNA
SNAH
SNAIL
SLUGH2
SNAIL1
dJ710H13.1

Gene

PDB

2Y48   3W5K   4QLI  

 GO Component (2)

Gene RIF (298)

PMID Text
26845447 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3beta/beta-catenin/Snail signaling pathway.
26711268 When Notch-downstream pathways were analyzed, the study detected an increase in glycogen synthase kinase 3 beta phosphorylation and inactivation that facilitates Snail1 nuclear retention and protein stabilization.
26648419 The present study was performed using LNCaP and PC3 cell lines, in which the expression levels of SNAIL1 were increased or silenced through the use of lentiviral vectors.
26617790 GM130 upregulated expression of the key epithelial-mesenchymal transformation regulator Snail (SNAI1), which mediated EMT activation and cell invasion by GM130.
26571812 SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition
26527679 loss of Scribble-induced HuR translocation mediates the accumulation of Snail via activation of the p38 MAPK pathway.
26510265 The strong association between Snail expression and lymph node metastasis suggests that Snail mRNA can be used as an adjunct to lymph node positivity to predict survival in pancreatic cancer.
26498709 Data demonstrated the possibility that Snail induces cancer stem cell (CSC)-like properties through epithelial-mesenchymal transition and maintains stemness by upregulating various CSC markers.
26362312 DDR2 plays an important role in promoting hepatocellular carcinoma cell invasion and migration by stabilizing SNA1.
26336990 Snail and DAB2IP interact to regulate EMT, invasion and metastasis in colorectal cancer
More...

AA Sequence

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ      1 - 70
PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA     71 - 140
QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC    141 - 210
PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR                    211 - 264
//

Text Mined References (326)

PMID Year Title
26845447 2016 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3?/?-catenin/Snail signaling pathway.
26711268 2015 A Switch in Akt Isoforms Is Required for Notch-Induced Snail1 Expression and Protection from Cell Death.
26648419 2016 SNAIL transcription factor increases the motility and invasive capacity of prostate cancer cells.
26617790 2015 GM130 regulates epithelial-to-mesenchymal transition and invasion of gastric cancer cells via snail.
26571812 [SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition].
26527679 2016 Loss of Scribble Promotes Snail Translation through Translocation of HuR and Enhances Cancer Drug Resistance.
26510265 2015 Snail transcript levels in diagnosis of pancreatic carcinoma with fine-needle aspirate.
26498709 2016 Snail-induced EMT promotes cancer stem cell-like properties in head and neck cancer cells.
26362312 2015 DDR2 facilitates hepatocellular carcinoma invasion and metastasis via activating ERK signaling and stabilizing SNAIL1.
26336990 2015 The positive feedback between Snail and DAB2IP regulates EMT, invasion and metastasis in colorectal cancer.
More...