Property Summary

NCBI Gene PubMed Count 384
PubMed Score 1782.86
PubTator Score 1817.62

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (359)

AA Sequence

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ      1 - 70
PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA     71 - 140
QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC    141 - 210
PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR                    211 - 264
//

Text Mined References (389)

PMID Year Title