Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.13
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95861 A8K7C8 B4DPS5 B4DUS9 D3DTA9 Q8WVL5 Q9UGJ3
Symbols PIP
HEL20

Gene

PANTHER Protein Class (2)

PDB

2WEF  

Gene RIF (1)

PMID Text
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT      1 - 70
IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA     71 - 140
YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM    141 - 210
NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN    211 - 280
SAGVLATLRNYDYYASRVPESIKNALVP                                              281 - 308
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...