Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.34
PubTator Score 2.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pancreatic cancer 2398 4.2e-05
mucosa-associated lymphoid tissue lymphoma 484 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.414 4.7e-02
pancreatic cancer 1.100 4.2e-05

Synonym

Accession O95858 Q6UW79 Tspan-15
Symbols NET7
NET-7
TM4SF15
2700063A19Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFLAPAIILILLG      1 - 70
VVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFLNDNIRRGIENYYDDLD     71 - 140
FKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSV    141 - 210
QDVIYVRGCTNAVIIWFMDNYTIMAGILLGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPS    211 - 280
VEAAGTGCCLCYPN                                                            281 - 294
//

Text Mined References (17)

PMID Year Title