Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.84
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.277 0.001
Chronic Lymphocytic Leukemia -3.807 0.000
Multiple myeloma 1.383 0.010
malignant mesothelioma -4.300 0.000
astrocytic glioma -1.800 0.006
ependymoma -2.500 0.016
esophageal adenocarcinoma 1.600 0.025
cystic fibrosis 2.456 0.000
atypical teratoid / rhabdoid tumor -1.500 0.006
glioblastoma -1.100 0.004
Duchenne muscular dystrophy 1.149 0.000
juvenile dermatomyositis 1.178 0.000
tuberculosis and treatment for 3 months 1.400 0.001
non-small cell lung cancer -1.054 0.000
lung cancer -1.100 0.000
lung adenocarcinoma -1.200 0.000
Pick disease -1.400 0.024
ductal carcinoma in situ 1.300 0.004
invasive ductal carcinoma 2.000 0.000
ovarian cancer -2.100 0.000

Gene RIF (7)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26713053 The TSPAN13-to-S100A9 ratio was selected to determine the diagnostic value of urinary nucleic acids in prostate cancer (PCa) (P = 0.037) and shown to be significantly higher in PCa than in benign prostatic hyperplasia.
25505242 The interaction of HIV-1 CA with human cellular tetraspanin 13 protein (TSPAN13) is identified by yeast two-hybrid screen
19148481 TSPAN13 is overexpressed in prostate cancer and its expression correlates with factors of favourable outcome.
19148481 tspan13 is overexpressed in prostate cancer and its expression correlates with factors of favourable outcome
17486367 NET-6 is a potent new breast cancer suppressor gene.
15958618 NET-6 may represent a novel breast cancer suppressor gene.

AA Sequence

MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKH      1 - 70
HQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTC     71 - 140
LASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL          141 - 204
//

Text Mined References (17)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26713053 2015 Urinary Nucleic Acid TSPAN13-to-S100A9 Ratio as a Diagnostic Marker in Prostate Cancer.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
19148481 2009 Gene expression profiling reveals overexpression of TSPAN13 in prostate cancer.
17486367 2007 The tetraspanin superfamily member NET-6 is a new tumor suppressor gene.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15958618 2005 Aberrant expression of novel and previously described cell membrane markers in human breast cancer cell lines and tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...