Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.87
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.800 6.1e-03
atypical teratoid / rhabdoid tumor -1.500 5.9e-03
Chronic Lymphocytic Leukemia -3.807 1.2e-04
cystic fibrosis 2.456 2.0e-06
Duchenne muscular dystrophy 1.149 3.0e-07
ductal carcinoma in situ 1.300 3.5e-03
ependymoma -2.500 1.6e-02
esophageal adenocarcinoma 1.600 2.5e-02
glioblastoma -1.100 3.8e-03
invasive ductal carcinoma 2.000 4.4e-04
juvenile dermatomyositis 1.178 3.8e-08
lung adenocarcinoma -1.200 1.1e-10
lung cancer -1.100 2.0e-04
malignant mesothelioma -4.300 1.9e-09
Multiple myeloma 1.383 1.0e-02
nephrosclerosis 1.277 6.7e-04
non-small cell lung cancer -1.054 3.0e-12
ovarian cancer -2.100 2.0e-06
Pick disease -1.400 2.4e-02
tuberculosis 1.300 2.5e-04

Synonym

Accession O95857 Tspan-13
Symbols NET6
NET-6
TM4SF13

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKH      1 - 70
HQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTC     71 - 140
LASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL          141 - 204
//

Text Mined References (17)

PMID Year Title