1. Home
  2. Targets
  3. hydrolase
  4. pyrophosphatase
  5. Uridine diphosphate glucose pyrophosphatase

Tdark Uridine diphosphate glucose pyrophosphatase

Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.

The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This enzyme contains a Nudix hydrolase domain and is a UDPG pyrophosphatase that hydrolyzes UDPG to produce glucose 1-phosphate and UMP. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

 Comments

Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.56
PubTator Score 4.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.67081508554189E-4
glioblastoma 5572 7.55688523806973E-4
sonic hedgehog group medulloblastoma 1482 0.0016243975891485
adult high grade glioma 2148 0.00547475658743247
Disease Target Count Z-score Confidence
Hard palate cancer 11 3.633 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 0.001
sonic hedgehog group medulloblastoma -1.400 0.002
adult high grade glioma -1.300 0.005
pilocytic astrocytoma -1.200 0.000

Synonym

Accession O95848 Q86SJ8 UDPG pyrophosphatase
Symbols UGPP
UGPPase

Gene

NUDT14

PANTHER Protein Class (2)

PDB

3Q91  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GO Function (3)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (19)

See all...

 IMPC Term (1)

 MGI Term (1)

 HCA RNA Cell Line (55)

See all...

Pathway (6)

 UniProt Keyword (6)

AA Sequence 

MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEV      1 - 70
ERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVA     71 - 140
TYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSW    141 - 210
FLSQVAPNLDLQ                                                              211 - 222
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429023 2003 Cloning, expression and characterization of a mammalian Nudix hydrolase-like enzyme that cleaves the pyrophosphate bond of UDP-glucose.
10662552 2000 Characterization, chromosomal localization, and the complete 30-kb DNA sequence of the human Jagged2 (JAG2) gene.