Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.47
PubTator Score 4.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 1.6e-04
glioblastoma 5792 7.6e-04
adult high grade glioma 3801 5.5e-03
group 4 medulloblastoma 1855 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hard palate cancer 10 3.645 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.300 5.5e-03
Astrocytoma, Pilocytic -1.200 1.6e-04
glioblastoma -1.100 7.6e-04
group 4 medulloblastoma -1.100 1.3e-02

Gene RIF (1)

AA Sequence

MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEV      1 - 70
ERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVA     71 - 140
TYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSW    141 - 210
FLSQVAPNLDLQ                                                              211 - 222
//

Text Mined References (11)

PMID Year Title