Property Summary

NCBI Gene PubMed Count 9
Grant Count 11
Funding $1,415,716.93
PubMed Score 5.56
PubTator Score 4.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma -1.100 0.001
sonic hedgehog group medulloblastoma -1.400 0.002
adult high grade glioma -1.300 0.005
pilocytic astrocytoma -1.200 0.000

AA Sequence

MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEV      1 - 70
ERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVA     71 - 140
TYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSW    141 - 210
FLSQVAPNLDLQ                                                              211 - 222
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429023 2003 Cloning, expression and characterization of a mammalian Nudix hydrolase-like enzyme that cleaves the pyrophosphate bond of UDP-glucose.
10662552 2000 Characterization, chromosomal localization, and the complete 30-kb DNA sequence of the human Jagged2 (JAG2) gene.