Property Summary

NCBI Gene PubMed Count 30
Grant Count 9
Funding $1,134,910.87
PubMed Score 39.63
PubTator Score 32.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.800 0.000
astrocytoma -1.300 0.000
glioblastoma -2.900 0.000
oligodendroglioma -1.200 0.000
cystic fibrosis 1.368 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.900 0.000
intraductal papillary-mucinous adenoma (... -1.900 0.000
Breast cancer -3.700 0.000
pediatric high grade glioma -2.300 0.000
lung carcinoma 1.600 0.000
breast carcinoma -1.300 0.000
Alzheimer's disease -1.200 0.026
Pick disease -2.100 0.000
ductal carcinoma in situ -1.300 0.004
invasive ductal carcinoma -1.700 0.003
ovarian cancer -3.400 0.000

Gene RIF (23)

PMID Text
26934480 UCP4 mRNA of cartilage tissues was decreased in osteoarthritis patients, which was negatively correlated with synovial fluid (SF) leptin concentration.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22580300 UCP4 is a target effector gene of the NF-kappaB c-Rel prosurvival pathway to mitigate the effects of oxidative stress.
22524567 Neuronal UCP4 exhibits transmembrane chloride transport activity.
22427795 Findings show how UCP4 overexpression increases ATP synthesis by specifically interacting with Complex II.
21621926 UCP4 expression correlated with lymph node metastases, positive estrogen/progesterone receptor expression, and positivity for p53 and Ki-67 in breast carcinomas.
21332312 the association found between the ultra-resistant schizophrenia group and the UCP4 haplotype is noteworthy as it may influence treatment outcome in schizophrenia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20545631 A homozygous genetic variant of mitochondrial uncoupling protein 4 affects the occurrence of leukoaraiosis.(
20545631 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRG      1 - 70
MVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVI     71 - 140
GQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTT    141 - 210
YDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQA    211 - 280
VQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF                               281 - 323
//

Text Mined References (32)

PMID Year Title
26934480 2016 Effects of UCP4 on the Proliferation and Apoptosis of Chondrocytes: Its Possible Involvement and Regulation in Osteoarthritis.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22580300 2012 UCP4 is a target effector of the NF-?B c-Rel prosurvival pathway against oxidative stress.
22524567 2012 Toward understanding the mechanism of ion transport activity of neuronal uncoupling proteins UCP2, UCP4, and UCP5.
22427795 2012 Uncoupling protein-4 (UCP4) increases ATP supply by interacting with mitochondrial Complex II in neuroblastoma cells.
21621926 2011 Mitochondrial UCP4 and bcl-2 expression in imprints of breast carcinomas: relationship with DNA ploidy and classical prognostic factors.
21332312 2011 Association of an UCP4 (SLC25A27) haplotype with ultra-resistant schizophrenia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20545631 2011 A homozygous genetic variant of mitochondrial uncoupling protein 4 affects the occurrence of leukoaraiosis.
20385226 2010 Transcriptional regulation of UCP4 by NF-kappaB and its role in mediating protection against MPP+ toxicity.
More...