Property Summary

NCBI Gene PubMed Count 31
PubMed Score 38.04
PubTator Score 32.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.500 3.5e-03
Alzheimer's disease -1.200 2.6e-02
astrocytoma -1.300 1.1e-09
atypical teratoid / rhabdoid tumor -1.800 5.5e-04
Breast cancer -2.600 2.5e-02
breast carcinoma -1.300 1.5e-21
cystic fibrosis 1.368 4.0e-04
ductal carcinoma in situ -1.300 4.3e-03
ependymoma -1.100 3.2e-02
glioblastoma -1.200 2.1e-03
intraductal papillary-mucinous adenoma (... -1.900 1.5e-04
invasive ductal carcinoma -1.700 2.5e-03
lung carcinoma 1.600 7.2e-18
medulloblastoma -1.400 1.3e-03
medulloblastoma, large-cell -1.800 3.9e-04
oligodendroglioma -1.200 5.7e-06
ovarian cancer -1.800 7.9e-11
Pick disease -1.500 5.3e-05
primitive neuroectodermal tumor -1.300 1.7e-03

Gene RIF (24)

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRG      1 - 70
MVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVI     71 - 140
GQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTT    141 - 210
YDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQA    211 - 280
VQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF                               281 - 323
//

Text Mined References (33)

PMID Year Title