Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.71
PubTator Score 12.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25970467 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of angiopoietin-like 1 (ANGPTL1) in primary human brain microvascular endothelial cells
23434592 ANGPTL1 represses lung cancer cell motility by abrogating the expression of the epithelial mesenchymal transformation mediator SLUG.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18644593 Overexpression of angiopoietin 1 and metalloproteinases may be the characteristic feature of endometrium with greater potential to transform into endometriotic lesions in the peritoneal cavity.
18182823 Immunohistochemical staining of Ang-1 was observed in smooth muscle cells, whereas Ang-2 was detected in endothelial cells, smooth muscle cells and macrophages.
15940350 Inhibits experimental melanoma growth when transfected into murine cells.

AA Sequence

MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKG      1 - 70
QDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHE     71 - 140
IIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTH    141 - 210
VSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDC    211 - 280
QQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYW    281 - 350
LGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT    351 - 420
LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPI    421 - 490
D//

Text Mined References (23)

PMID Year Title
25970467 2015 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23434592 2013 Angiopoietin-like protein 1 suppresses SLUG to inhibit cancer cell motility.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18644593 2009 Metalloproteinases, vascular endothelial growth factor, and angiopoietin 1 and 2 in eutopic and ectopic endometrium.
18182823 2008 Balance between angiopoietin-1 and angiopoietin-2 is in favor of angiopoietin-2 in atherosclerotic plaques with high microvessel density.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15950186 2005 Angioarrestin: a unique angiopoietin-related protein with anti-angiogenic properties.
More...