Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.31
PubTator Score 12.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical adenoma -1.172 2.6e-02
adrenocortical carcinoma -2.074 6.8e-06
aldosterone-producing adenoma -1.437 1.8e-02
Atopic dermatitis -2.100 6.2e-05
breast carcinoma -2.300 3.4e-07
ductal carcinoma in situ -1.600 1.1e-02
ependymoma 2.500 4.6e-05
fibroadenoma -1.400 1.9e-02
glioblastoma 1.200 1.4e-02
interstitial cystitis 1.200 2.5e-02
intraductal papillary-mucinous adenoma (... -1.600 7.4e-05
intraductal papillary-mucinous carcinoma... -1.700 1.0e-04
intraductal papillary-mucinous neoplasm ... -1.700 1.5e-03
invasive ductal carcinoma -2.229 3.1e-03
juvenile dermatomyositis 1.360 1.8e-10
lung adenocarcinoma -2.200 6.3e-16
lung carcinoma -2.700 7.3e-19
non-small cell lung cancer -1.134 2.7e-12
osteosarcoma 1.800 2.5e-02
ovarian cancer -1.300 4.6e-08
pancreatic cancer -1.100 1.7e-04
pediatric high grade glioma 1.700 1.1e-03

Synonym

Accession O95841 Q5T5Z5
Symbols ANG3
ARP1
AngY
ANGPT3
UNQ162
dJ595C2.2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKG      1 - 70
QDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHE     71 - 140
IIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTH    141 - 210
VSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDC    211 - 280
QQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYW    281 - 350
LGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTT    351 - 420
LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPI    421 - 490
D//

Text Mined References (25)

PMID Year Title