Property Summary

NCBI Gene PubMed Count 24
Grant Count 11
R01 Count 4
Funding $534,400.33
PubMed Score 23.76
PubTator Score 29.84

Knowledge Summary

Patent (3,733)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.100 0.001
fibroadenoma -1.400 0.044

Gene RIF (16)

PMID Text
24875097 Report gastrointestinal GLP-2 receptor and limited utility of GLP-2 in the management of inflammatory intestinal disorders.
22951144 GLP-2 receptors are highly expressed in gastrointestinal stromal tumors and Crohn's disease.
21326311 GLP2R encodes a G protein-coupled receptor and involved in proliferative and anti-apoptotic cellular responses.
21167157 docking studies were performed between the N-terminal extracellular domain of GLP-2 receptor and the GLP-2 hormone
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLE      1 - 70
ETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQ     71 - 140
GTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQLMYTVGYSFSLISLFLALTLLLFLRKLHCTR    141 - 210
NYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLV    211 - 280
EGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLC    281 - 350
VTVNFFIFLKILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI    351 - 420
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKKLSEGDGAEKL    421 - 490
RKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI           491 - 553
//

Text Mined References (25)

PMID Year Title
24990862 2014 The CNS glucagon-like peptide-2 receptor in the control of energy balance and glucose homeostasis.
24875097 2014 Glugacon-like peptide-2: broad receptor expression, limited therapeutic effect on intestinal inflammation and novel role in liver regeneration.
22951144 2012 GLP-2 receptors in human disease: high expression in gastrointestinal stromal tumors and Crohn's disease.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
21167157 2011 Conformational and molecular interaction studies of glucagon-like peptide-2 with its N-terminal extracellular receptor domain.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...