Property Summary

NCBI Gene PubMed Count 28
PubMed Score 4.51
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.634 1.3e-03
active ulcerative colitis 1.492 9.7e-03
astrocytic glioma -1.300 1.0e-02
colon cancer -1.100 9.5e-03
ependymoma -1.800 4.7e-03
group 3 medulloblastoma -2.100 3.7e-03
lung cancer -1.600 2.9e-04
lung carcinoma -2.600 3.5e-19
medulloblastoma, large-cell -1.100 2.4e-02
non-small cell lung cancer -1.038 7.0e-09
oligodendroglioma -1.600 3.2e-03
pituitary cancer -1.200 4.2e-02
primitive neuroectodermal tumor -1.100 4.3e-02
urothelial carcinoma -2.700 4.9e-04

Gene RIF (12)

AA Sequence

MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKG      1 - 70
FTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQEC     71 - 140
YDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERR    141 - 210
KWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIM    211 - 280
YSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLR    281 - 350
EFNLV                                                                     351 - 355
//

Text Mined References (30)

PMID Year Title