Property Summary

NCBI Gene PubMed Count 26
PubMed Score 4.34
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 3.51625735592525E-19
non-small cell lung cancer 2798 6.98631406874692E-9
lung cancer 4473 2.91241732780597E-4
urothelial carcinoma 318 4.88983226274568E-4
active Crohn's disease 918 0.00132622152641992
oligodendroglioma 2849 0.00324995306668047
group 3 medulloblastoma 2254 0.00367137323068744
ependymoma 2514 0.0046596664624653
colon cancer 1475 0.00953015531569964
active ulcerative colitis 477 0.00972907062192021
astrocytic glioma 2241 0.00995217017766646
medulloblastoma, large-cell 6234 0.0239641871635189
pituitary cancer 1972 0.0417515961310896
primitive neuroectodermal tumor 3031 0.0428745737918288
Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 2.0
Disease Target Count Z-score Confidence
chorea-acanthocytosis 11 3.551 1.8
Disease Target Count
Angioma, Tufted 1

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -2.700 0.000
astrocytic glioma -1.300 0.010
ependymoma -1.800 0.005
oligodendroglioma -1.600 0.003
group 3 medulloblastoma -2.100 0.004
medulloblastoma, large-cell -1.100 0.024
primitive neuroectodermal tumor -1.100 0.043
non-small cell lung cancer -1.038 0.000
colon cancer -1.100 0.010
lung cancer -1.600 0.000
active Crohn's disease 1.634 0.001
active ulcerative colitis 1.492 0.010
lung carcinoma -2.600 0.000
pituitary cancer -1.200 0.042

Synonym

Accession O95837 B1ALW3 G alpha-14
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (10)

PMID Text
26377666 Study suggests that the previously identified PLCbeta-interacting residues are insufficient to ensure productive interaction of Galpha14 with PLCbeta, while an intact N-terminal half of Galpha14 is apparently required for PLCbeta interaction.
23975421 TNF-alpha/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
22711498 TPR1 is required for Galpha14 to stimulate Ras-dependent signaling pathways, but not for the propagation of signals along Ras-independent pathways.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19687291 The ability of CCR1 to signal through Galpha(14/16) thus provides a linkage for chemokines to regulate NF-kappaB-dependent responses.
18360038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17620339 G14alpha and G16alpha are palmitoylated at distinct polycysteine sequences, and that the adjacent polybasic domain is not required for Galpha palmitoylation but is important for localization and functional activity of heterotrimeric G proteins
16115892 activation of the IKK/NFkappaB signaling cascade by SSTR2 requires a complicated network consisting of Galpha(14), protein kinase C, CamkII, ERK, and c-Src

AA Sequence

MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKG      1 - 70
FTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQEC     71 - 140
YDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERR    141 - 210
KWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIM    211 - 280
YSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLR    281 - 350
EFNLV                                                                     351 - 355
//

Text Mined References (28)

PMID Year Title
26377666 2015 An intact helical domain is required for G?14 to stimulate phospholipase C?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23975421 2014 TNF-?/TNFR1 signaling promotes gastric tumorigenesis through induction of Noxo1 and Gna14 in tumor cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22711498 2012 Activation of Ras-dependent signaling pathways by G(14) -coupled receptors requires the adaptor protein TPR1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...