Property Summary

NCBI Gene PubMed Count 69
Grant Count 46
R01 Count 36
Funding $3,526,142.24
PubMed Score 158.31
PubTator Score 67.48

Knowledge Summary

Patent (7,672)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.312 0.000
group 4 medulloblastoma 1.700 0.001
tuberculosis and treatment for 6 months 1.300 0.000
ovarian cancer -1.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (49)

PMID Text
26116754 PARD3 promotes interaction between PP1A and LATS1 to induce LATS1 dephosphorylation and inactivation,leading to dephosphorylation and activation of TAZ
25841306 Both LATS1 and LATS2 were not related with the clinical variables in mucinous and clear cell carcinoma
25786116 Phosphorylation of CHO1 at S716 by Lats1 regulate its centrosomal localization, and that phosphorylated CHO1 interacts with and activates LIMK1 during early mitosis.
25772246 Loss of LATS1 expression is associated with breast neoplasms.
25743838 LATS1 promoter hypermethylation is associated with oral squamous cell carcinomas.
25723520 LATS1 phosphorylates the Thr7 residue of the APC/C component CDC26 directly
25658096 Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms.
25625370 These results demonstrated that as an inhibitor of YAP, LATS1 was decreased via downregulation of YAP using RNAi. This therefore indicated that the change in YAP levels in hepatocellular carcinoma cells may regulate LATS1 in a feedback manner.
25618271 ITCH up-regulation and LATS1 down-regulation were closely associated with tumorigenesis and progression of SCC
25482410 results reported here further support that LATS1/2 act normally as tumor suppressors and loss of their functions contributes to human cancer development
More...

AA Sequence

MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPK      1 - 70
FGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISK     71 - 140
MSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTD    141 - 210
VGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGN    211 - 280
MEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNG    281 - 350
TGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME    351 - 420
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAIT    421 - 490
PAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYP    491 - 560
KHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESR    561 - 630
IQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKM    631 - 700
DKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYY    701 - 770
SFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG    771 - 840
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSL    841 - 910
VGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPE    911 - 980
ASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSD    981 - 1050
DNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGS   1051 - 1120
EIKNRDLVYV                                                               1121 - 1130
//

Text Mined References (78)

PMID Year Title
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
25841306 2015 Expression of LATS family proteins in ovarian tumors and its significance.
25786116 2015 Phosphorylation of CHO1 by Lats1/2 regulates the centrosomal activation of LIMK1 during cytokinesis.
25772246 2015 Cell growth density modulates cancer cell vascular invasion via Hippo pathway activity and CXCR2 signaling.
25743838 2015 Hypermethylation of promoter region of LATS1--a CDK interacting protein in oral squamous cell carcinomas--a pilot study in India.
25723520 2015 LATS1 and LATS2 phosphorylate CDC26 to modulate assembly of the tetratricopeptide repeat subcomplex of APC/C.
25658096 2015 Binding of Kif23-iso1/CHO1 to 14-3-3 is regulated by sequential phosphorylations at two LATS kinase consensus sites.
25625370 2015 Knockdown of yes-associated protein inhibits proliferation and downregulates large tumor suppressor 1 expression in MHCC97H human hepatocellular carcinoma cells.
25618271 2014 Up-regulation of ITCH is associated with down-regulation of LATS1 during tumorigenesis and progression of cervical squamous cell carcinoma.
25482410 2015 Mutation analysis of large tumor suppressor genes LATS1 and LATS2 supports a tumor suppressor role in human cancer.
More...