Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.11
PubTator Score 3.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
juvenile dermatomyositis -1.097 0.000
adult high grade glioma -1.500 0.000
ovarian cancer -1.500 0.000

Synonym

Accession O95834 B7Z3I2 B7Z3Q9 K7ERL7 Q59EN8 Q8N5A2 Q9UG50 EMAP-2
Symbols ELP70
EMAP2
EMAP-2

Gene

PDB

4CGB  

Gene RIF (4)

PMID Text
25740311 We have determined crystal structures of the coiled-coils from EML2 and EML4, which describe the structural basis of both EML self-association and oncogenic EML4-ALK activation.
24318111 Both EMAP II and CXCR3 were essentially required for gp120-induced lung microvascular endothelial cell apoptosis.
24318111 The interaction of CXCR4 with HIV-1 gp120 mediates gp120-induced upregulation of the CXCR3 and EMAP2 expression in human lung microvascular endothelial cells
24318111 The interaction of CXCR4 with HIV-1 gp120 mediates gp120-induced upregulation of the CXCR3 and EMAP2 expression in human lung microvascular endothelial cells

AA Sequence

MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRA      1 - 70
NLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVR     71 - 140
IWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLV    141 - 210
ATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGK    211 - 280
GGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDT    281 - 350
LYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDP    351 - 420
ARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVD    421 - 490
QGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLG    491 - 560
FGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDD    561 - 630
SMALTTGGKDTSVLQWRVV                                                       631 - 649
//

Text Mined References (16)

PMID Year Title
25740311 2015 Microtubule association of EML proteins and the EML4-ALK variant 3 oncoprotein require an N-terminal trimerization domain.
25416956 2014 A proteome-scale map of the human interactome network.
24706829 2014 Crystal structure of EML1 reveals the basis for Hsp90 dependence of oncogenic EML4-ALK by disruption of an atypical ?-propeller domain.
24318111 2014 HIV envelope protein gp120-induced apoptosis in lung microvascular endothelial cells by concerted upregulation of EMAP II and its receptor, CXCR3.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...