Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.27
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.500 4.1e-05
atypical teratoid / rhabdoid tumor -1.100 1.6e-04
glioblastoma -1.200 8.0e-04
group 3 medulloblastoma -1.300 1.5e-03
juvenile dermatomyositis -1.097 1.1e-11
medulloblastoma, large-cell -1.800 8.6e-07
ovarian cancer -1.500 8.3e-07

Gene RIF (3)

AA Sequence

MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRA      1 - 70
NLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVR     71 - 140
IWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLV    141 - 210
ATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGK    211 - 280
GGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDT    281 - 350
LYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDP    351 - 420
ARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVD    421 - 490
QGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLG    491 - 560
FGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDD    561 - 630
SMALTTGGKDTSVLQWRVV                                                       631 - 649
//

Text Mined References (18)

PMID Year Title