Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.15
PubTator Score 9.49

Knowledge Summary

Patent (1,108)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 9.25471021113199E-23
ovarian cancer 8492 1.7429173697311E-8
lung adenocarcinoma 2714 4.6611218225411E-7
cystic fibrosis 1670 4.96223121362082E-7
nasopharyngeal carcinoma 1056 7.48491420473532E-6
pancreatic cancer 2300 1.85987146695386E-5
malignant mesothelioma 3163 2.44819909696542E-5
tuberculosis and treatment for 6 months 686 0.00118941035552192
psoriasis 6685 0.0121380509942539
type I diabetes mellitus 22 0.0136530534078549
pancreatic carcinoma 567 0.0183929472465114
esophageal adenocarcinoma 737 0.0202578998338136

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 2.000 0.000
malignant mesothelioma 1.400 0.000
esophageal adenocarcinoma -3.600 0.020
psoriasis 1.400 0.012
cystic fibrosis -2.097 0.000
tuberculosis and treatment for 6 months -2.000 0.001
non-small cell lung cancer -2.958 0.000
pancreatic carcinoma -1.400 0.018
lung adenocarcinoma -1.700 0.000
nasopharyngeal carcinoma -1.900 0.000
ovarian cancer -2.200 0.000
type I diabetes mellitus -1.180 0.014

Synonym

Accession O95833 Q5SPZ7
Symbols

Gene

PDB

3FY7   3KJY  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
26445368 in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls
25015290 CLIC3 controls trafficking of late endosomal MT1-MMP and dictates invasion and metastasis in breast cancer.
22795578 results suggest that increased expression of chloride intracellular channel 3 (CLIC3) may play a role in abnormal placental function associated with the human pregnancy disorders fetal growth restrict and pre-eclampsia
20146363 The structure of the soluble form of CLIC3, is presented.
17027078 CLIC3 facilitates chloride ion movement and regulates cellular processes associated with the movement of chloride in placental and fetal membrane cells.

AA Sequence

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD      1 - 70
AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDS     71 - 140
YLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM    141 - 210
QEKEFKYTCPHSAEILAAYRPAVHPR                                                211 - 236
//

Text Mined References (18)

PMID Year Title
26445368 2015 Transcriptional over-expression of chloride intracellular channels 3 and 4 in malignant pleural mesothelioma.
25416956 2014 A proteome-scale map of the human interactome network.
25015290 2014 CLIC3 controls recycling of late endosomal MT1-MMP and dictates invasion and metastasis in breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22795578 2012 Placental CLIC3 is increased in fetal growth restriction and pre-eclampsia affected human pregnancies.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20146363 2010 Structure of human CLIC3 at 2 A resolution.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...