Property Summary

NCBI Gene PubMed Count 181
Grant Count 9
R01 Count 6
Funding $848,078.1
PubMed Score 111.21
PubTator Score 420.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
sonic hedgehog group medulloblastoma 2.800 0.000
cystic fibrosis 1.624 0.000
atypical teratoid / rhabdoid tumor 2.600 0.013
Atopic dermatitis -1.300 0.001
non-small cell lung cancer 2.331 0.000
colon cancer 3.000 0.003
lung cancer -4.200 0.000
active Crohn's disease 2.544 0.002
ulcerative colitis 2.900 0.000
pancreatic cancer 1.200 0.003
interstitial cystitis -2.600 0.002
lung adenocarcinoma 2.000 0.000
pilocytic astrocytoma 1.500 0.001
aldosterone-producing adenoma -1.820 0.017
psoriasis -1.600 0.000
lung carcinoma -2.100 0.000
spina bifida -2.187 0.037
Breast cancer -1.800 0.000
gastric carcinoma 3.300 0.037
ductal carcinoma in situ 1.200 0.044
ovarian cancer 4.000 0.000
pituitary cancer 1.700 0.034

Gene RIF (154)

PMID Text
26662145 autotypic tight junctions molecular composition, like claudin-1 and occludin expression could influence the demyelinating process by altering the permeability of the blood-nerve barrier.
26554238 There was no difference in the frequency of fractures or renal lithiasis between the rs219780 genotype groups in PHPT patients. Nor was there any relationship between the T or C alleles and BMD or biochemical parameters.
26463354 High CLDN1 expression is associated with Cervical cancer.
26436506 Claudin-1 expression was correlated with lymphatic microvessel generation in hypopharyngeal squamous cell carcinoma and with patient survival.
26361141 delocalization of claudin-1 induced by PKC phosphorylation contributes to metastatic capacity of osteosarcoma cells
26219679 High CLAUDIN-1 expression is associated with metastasis in follicular thyroid carcinoma.
26157141 CLD1-mediated hepatoma cell invasiveness occurs via heat shock factor 1 (HSF1) activation.
26122225 Positive expressions of Claudin-1 in retinoblastoma were fewer than those in retina; higher positive expressions were found in differentiated tissues than in undifferentiated tissues; Claudin-1 expressed more positively in optic nerves without invasion.
26023235 Phosphorylation state of the tyrosine of claudin-1 and claudin-2 regulates interaction with ZO1.
25964581 Our results indicate that CLDN4 expression is correlated with poor prognosis, and CLDN1 expression may be an indicator of recurrence of oral squamous cell carcinoma.
More...

AA Sequence

MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSL      1 - 70
LNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWY     71 - 140
GNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDY    141 - 210
V//

Text Mined References (184)

PMID Year Title
26662145 2015 Claudin-1 and occludin expression in demyelinating peripheral neuropathies.
26554238 2015 Rs219780 SNP of Claudin 14 Gene is not Related to Clinical Expression in Primary Hyperparathyroidism.
26463354 2016 Claudin-1 as a Biomarker of Cervical Cytology and Histology.
26436506 2015 Expression of claudin-1 and its relationship with lymphatic microvessel generation in hypopharyngeal squamous cell carcinoma.
26361141 2015 Delocalized Claudin-1 promotes metastasis of human osteosarcoma cells.
26219679 2015 The impact of CLAUDIN-1 on follicular thyroid carcinoma aggressiveness.
26157141 2015 Mitochondrial Respiratory Dysfunction Induces Claudin-1 Expression via Reactive Oxygen Species-mediated Heat Shock Factor 1 Activation, Leading to Hepatoma Cell Invasiveness.
26122225 HOW EXPRESSIONS OF CLAUDIN-1 AND MMP-2 IN RETINOBLASTOMA CORRELATE WITH HISTOLOGICAL DIFFERENTIATION AND OPTIC NERVE INVASION.
26023235 2015 Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
25964581 2015 The prognostic role of claudins -1 and -4 in oral squamous cell carcinoma.
More...