Property Summary

NCBI Gene PubMed Count 207
PubMed Score 126.72
PubTator Score 420.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.4
Disease Target Count Z-score Confidence
Ichthyosis 56 3.801 1.9
Cancer 2499 3.508 1.8
Barth syndrome 23 3.295 1.6

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 2.544 1.9e-03
active ulcerative colitis 2.123 2.4e-03
aldosterone-producing adenoma -1.820 1.7e-02
Astrocytoma, Pilocytic 1.500 5.1e-04
Atopic dermatitis -1.100 2.3e-02
atypical teratoid / rhabdoid tumor 1.600 2.6e-02
Breast cancer -1.800 2.5e-04
colon cancer 2.400 2.5e-02
cystic fibrosis 1.503 2.8e-05
ductal carcinoma in situ 1.200 4.4e-02
gastric carcinoma 3.300 3.7e-02
interstitial cystitis -2.000 1.4e-04
lung adenocarcinoma 1.100 1.2e-04
lung cancer -3.300 4.7e-05
lung carcinoma -2.100 8.3e-08
medulloblastoma 1.300 3.9e-02
non-small cell lung cancer 2.331 3.2e-09
ovarian cancer -3.700 6.2e-07
pancreatic cancer 1.100 6.7e-03
pituitary cancer 1.700 3.4e-02
psoriasis -1.300 2.3e-43
spina bifida -1.999 2.3e-02

Gene RIF (179)

AA Sequence

MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSL      1 - 70
LNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWY     71 - 140
GNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDY    141 - 210
V//

Text Mined References (211)

PMID Year Title