Property Summary

NCBI Gene PubMed Count 169
Grant Count 9
R01 Count 8
Funding $1,068,551.73
PubMed Score 43.94
PubTator Score 112.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -2.478 0.001
lung cancer 1.100 0.001
lung adenocarcinoma 1.247 0.000

Gene RIF (100)

PMID Text
26920061 strongly support a direct relationship between AIF nuclear translocation and radiation induced cell death in hepatocellular carcinoma cell line HepG2
26415504 Results identify PTEN as the substrate of AIF oxidoreductase and reveal a novel function for AIF in controlling tumor metastasis.
26237213 Residues Regulating the Reductase Activity of the Human Mitochondrial Apoptosis Inducing Factor
26206088 Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to truncated AIF mediated neuronal cell death progression following neurotoxic stimuli.
26165468 AIF bears a HSP-70 binding domain allowing association with HSP-70.
26119781 identification of the novel interaction between Trx1 and AIF has provided opportunities to design and develop therapeutically relevant strategies that either promote or prevent this protein-protein interaction for the treatment of different disease
26063804 AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type).
26012840 UDA decreased the St-induced changes in mitochondrial and cytosolic AIF level, whereas in Dox-model it affected only the cytosolic AIF content.
26004228 Data indicate that poptosis-inducing factor (AIF) controls the mitochondrial import of mitochondrial membrane transport protein CHCHD4.
25986071 Missense mutations in AIFM1 are associated with X-linked recessive auditory neuropathy spectrum disorder.
More...

AA Sequence

MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLV      1 - 70
LIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGG     71 - 140
TAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSF    141 - 210
YVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSR    211 - 280
TTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSN    281 - 350
WTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG    351 - 420
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDV    421 - 490
GYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDY    491 - 560
GKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED                     561 - 613
//

Text Mined References (177)

PMID Year Title
26920061 2016 Caspase-independent cell death mediated by apoptosis-inducing factor (AIF) nuclear translocation is involved in ionizing radiation induced HepG2 cell death.
26415504 2015 AIF inhibits tumor metastasis by protecting PTEN from oxidation.
26313918 2015 The novel protective role of P27 in MLN4924-treated gastric cancer cells.
26313915 2015 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26304929 2015 Targeting activating mutations of EZH2 leads to potent cell growth inhibition in human melanoma by derepression of tumor suppressor genes.
26293804 2016 TPGS/Phospholipids Mixed Micelles for Delivery of Icariside II to Multidrug-Resistant Breast Cancer.
26259540 2015 Heart mitochondria and calpain 1: Location, function, and targets.
26258875 2016 FV-429 induces apoptosis and inhibits glycolysis by inhibiting Akt-mediated phosphorylation of hexokinase II in MDA-MB-231 cells.
26252009 2015 Embelin-Induced Apoptosis of Human Prostate Cancer Cells Is Mediated through Modulation of Akt and ?-Catenin Signaling.
26237213 2015 Key Residues Regulating the Reductase Activity of the Human Mitochondrial Apoptosis Inducing Factor.
More...