Property Summary

NCBI Gene PubMed Count 22
Grant Count 36
R01 Count 21
Funding $4,117,132.14
PubMed Score 44.23
PubTator Score 72.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (11)

PMID Text
23791943 The MLYCD catalytic domain is structurally homologous to those of the GCN5-related N-acetyltransferase superfamily.
23482565 Structural asymmetry and disulfide bridges among subunits modulate the activity of human malonyl-CoA decarboxylase.
22778304 Our case emphasizes the need for ongoing cardiac disease screening in patients with MCD deficiency and the benefits and limitations of current dietary interventions.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20702857 This study of fatty acid oxidation and malonyl-CoA decarboxylase identifies a critical role for metabolism in both the normal pulmonary circulation (hypoxic pulmonary vasoconstriction) and pulmonary hypertension
18660489 Observational study of gene-disease association. (HuGE Navigator)
18614968 Data suggest that increased expression of malonyl CoA decarboxylase, and the decreased expression of acetyl CoA carboxylase and 5'-AMP activated protein kinase are important regulators of the maturation of fatty acid oxidation in the newborn human heart.
18314420 MCD silencing suppresses lipid uptake and enhances glucose uptake in primary human myotubes.
17186413 analysis of nine novel MLYCD mutations in patients with malonyl-coenzyme A decarboxylase deficiency
16434556 The concentration of malonyl-CoA is diminished in muscle after physical training, most likely because of PGC-1alpha-mediated increases in MCD expression and activity.
More...

AA Sequence

MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKTPAPAEGQCAD      1 - 70
FVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGL     71 - 140
FHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQ    141 - 210
KISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEK    211 - 280
NKITAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHG    281 - 350
RNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA    351 - 420
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKN    421 - 490
SKL                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23791943 2013 Crystal structures of malonyl-coenzyme A decarboxylase provide insights into its catalytic mechanism and disease-causing mutations.
23482565 2013 Structural asymmetry and disulfide bridges among subunits modulate the activity of human malonyl-CoA decarboxylase.
22778304 2012 Malonyl coenzyme A decarboxylase deficiency: early dietary restriction and time course of cardiomyopathy.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20702857 2010 Fatty acid oxidation and malonyl-CoA decarboxylase in the vascular remodeling of pulmonary hypertension.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18614968 2008 Myocardial hypertrophy and the maturation of fatty acid oxidation in the newborn human heart.
18314420 2008 Malonyl CoenzymeA decarboxylase regulates lipid and glucose metabolism in human skeletal muscle.
More...