Property Summary

NCBI Gene PubMed Count 36
Grant Count 186
R01 Count 124
Funding $11,341,599.97
PubMed Score 141.31
PubTator Score 52.17

Knowledge Summary

Patent (49,874)

Expression

Synonym

Accession O95819 O75172 Q9NST7
Symbols HGK
NIK
MEKKK4
FLH21957
HEL-S-31

Gene

PDB

4OBO   4OBP   4OBQ   4RVT   4U3Y   4U3Z   4U40   4U41   4U42   4U43   4U44   4U45   4ZK5   5DI1  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (17)

PMID Text
26722431 miR-194 regulated the progression of hepatocellular carcinoma through directly inhibiting the expression of MAP4K4
26549737 The results of the present study suggested that inhibition of MAP4K4 may be a therapeutic strategy for gastric cancer.
25799996 loss of MAP4K4 function suppressed pathological angiogenesis in disease models, identifying MAP4K4 as a potential therapeutic target
24244164 that MAP4K4, a known mediator of inflammation, is involved in KS aetiology by regulating KSHV lytic reactivation
24233838 results reveal a key target of SOX2 expression and highlight the unexpected context-dependent role for MAP4K4, a pluripotent activator of several mitogen-activated protein kinase pathways, in regulating tumor cell survival.
23543740 TRAF1.NIK is a central complex linking canonical and non-canonical pathways by disrupting the TRAF2-cIAP2 ubiquitin ligase complex
23094072 Common polymorphisms in MAP4K4 are associated with insulin resistance and beta-cell dysfunction, possibly via this gene's role in inflammatory signaling.
22824148 Elevated MAP4K4 expression is closely associated with lung adenocarcinoma progression with independent prognostic value in predicting overall survival for patients with lung adenocarcinoma.
21196414 MAP4K4 overexpression is an independent predictor of poor prognosis of Hepatocellular Carcinoma patients, and inhibition of its expression might be of therapeutic significance
20857524 Data show that down-regulation of hepatocyte progenitor kinase-like kinase (HGK) can obviously inhibit the migration and invasion of HepG2 cells in vitro, and suggest that HGK may be a new therapeutic target for treatment of hepatocellular carcinoma.
More...

AA Sequence

MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEI      1 - 70
NMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRG     71 - 140
LAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY    141 - 210
DYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPST    211 - 280
EQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGES    281 - 350
TLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR    351 - 420
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ    421 - 490
AMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHY    491 - 560
EPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESVHPALQRPAEPQVPVRTTSR    561 - 630
SPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGS    631 - 700
GERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEE    701 - 770
SGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT    771 - 840
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTR    841 - 910
PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLV    911 - 980
TISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAW    981 - 1050
APKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPH   1051 - 1120
AIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGH   1121 - 1190
LDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW                        1191 - 1239
//

Text Mined References (50)

PMID Year Title
26722431 2015 MicroRNA-194 acts as a prognostic marker and inhibits proliferation in hepatocellular carcinoma by targeting MAP4K4.
26549737 2016 Silencing of MAP4K4 by short hairpin RNA suppresses proliferation, induces G1 cell cycle arrest and induces apoptosis in gastric cancer cells.
25799996 2015 MAP4K4 regulates integrin-FERM binding to control endothelial cell motility.
25625039 2015 The Ser/Thr kinase MAP4K4 drives c-Met-induced motility and invasiveness in a cell-based model of SHH medulloblastoma.
25601402 2015 The Nck-interacting kinase NIK increases Arp2/3 complex activity by phosphorylating the Arp2 subunit.
24626571 2014 Intracellular Theileria annulata promote invasive cell motility through kinase regulation of the host actin cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244164 2013 The inflammatory kinase MAP4K4 promotes reactivation of Kaposi's sarcoma herpesvirus and enhances the invasiveness of infected endothelial cells.
24233838 2014 SOX2 regulates apoptosis through MAP4K4-survivin signaling pathway in human lung cancer cells.
23543740 2013 Inducible tumor necrosis factor (TNF) receptor-associated factor-1 expression couples the canonical to the non-canonical NF-?B pathway in TNF stimulation.
More...