Property Summary

Ligand Count 25
NCBI Gene PubMed Count 41
PubMed Score 152.56
PubTator Score 52.17

Knowledge Summary

Patent (49,874)

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma 1.600 2.3e-02
Atopic dermatitis 1.100 1.9e-04
Chronic Lymphocytic Leukemia -1.331 9.2e-05
diabetes mellitus -1.300 2.6e-03
Down syndrome 1.600 4.5e-03
gastric carcinoma 1.400 2.2e-02
interstitial cystitis 1.100 5.8e-05
intraductal papillary-mucinous adenoma (... 1.500 7.9e-03
intraductal papillary-mucinous carcinoma... 1.500 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-02
lung cancer 1.400 1.3e-04
medulloblastoma 1.100 2.7e-03
nephrosclerosis 1.110 8.4e-04
oligodendroglioma 2.000 7.2e-03
ovarian cancer -1.600 9.2e-09
pancreatic cancer 1.100 1.9e-05
Pick disease 1.100 9.2e-04
primary pancreatic ductal adenocarcinoma 1.002 2.2e-02
primary Sjogren syndrome 1.200 7.2e-03
primitive neuroectodermal tumor 1.300 1.9e-02
ulcerative colitis 1.100 2.0e-05

 GWAS Trait (1)

PDB (16)

Gene RIF (22)

AA Sequence

MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEI      1 - 70
NMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRG     71 - 140
LAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY    141 - 210
DYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPST    211 - 280
EQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGES    281 - 350
TLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR    351 - 420
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLEVLQQQLLQEQ    421 - 490
AMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPPPPQQERSKPSFHAPEPKAHY    491 - 560
EPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSESVHPALQRPAEPQVPVRTTSR    561 - 630
SPVLSRRDSPLQGSGQQNSQAGQRNSTSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGS    631 - 700
GERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPADLTALAKELRAVEDVRPPHKVTDYSSSSEE    701 - 770
SGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQT    771 - 840
QSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTR    841 - 910
PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLV    911 - 980
TISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAW    981 - 1050
APKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPH   1051 - 1120
AIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGH   1121 - 1190
LDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW                        1191 - 1239
//

Text Mined References (56)

PMID Year Title