Property Summary

NCBI Gene PubMed Count 143
Grant Count 50
R01 Count 19
Funding $4,557,379.17
PubMed Score 181.77
PubTator Score 147.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.023
psoriasis 1.700 0.001
osteosarcoma 2.219 0.000
group 4 medulloblastoma -1.900 0.003
astrocytoma 2.000 0.006
medulloblastoma, large-cell -2.600 0.002
primitive neuroectodermal tumor -1.100 0.006
lung cancer -1.900 0.000
active Crohn's disease 1.319 0.013
ulcerative colitis 1.600 0.000
lung carcinoma -1.200 0.000
spina bifida -1.019 0.038
ovarian cancer 2.000 0.000
pituitary cancer -2.500 0.000

 GWAS Trait (1)

Gene RIF (116)

PMID Text
26707573 The present study, for the first time, examined the expression of central autophagy proteins BAG3 and p62 in testicular cancer
26655271 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10 and modulates cisplatin resistance.
26621836 Data indicate a tumor suppressor-like function of Bcl-2 associated athanogene 3 (BAG3) via direct interaction with glucose 6 phosphate dehydrogenase (G6PD) in hepatocellular carcinomas (HCCs) at the cellular level.
26545904 BAG3 is associated with Z-disc maintenance.
26541455 MiR-143 enhanced the tumor suppressive effect of shikonin partly through the regulation of BAG3 in glioblastoma stem cells.
26522614 BAG3 promotes pancreatic ductal adenocarcinoma growth by activating stromal macrophages.
26496431 our findings suggest the existence of a so-far unrecognized quality control mechanism involving BAG3, HSPB8 and p62/SQSTM1 for accurate remodelling of actin-based mitotic structures that guide spindle orientation.
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
26159920 BAG3 plays a key role in the processing of the nucleocytoplasmic shuttling of HSF1 upon heat stress
26158518 This newly described ERa-mediated and estrogen response element (ERE)-independent non-canonical autophagy pathway, which involves the function of BAG3 and provides stress resistance in our model systems.
More...

AA Sequence

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPS      1 - 70
REGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRG     71 - 140
MPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPV    141 - 210
IHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP    211 - 280
ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKP    281 - 350
VSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP    351 - 420
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTI    421 - 490
LEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS    491 - 560
NPSSMTDTPGNPAAP                                                           561 - 575
//

Text Mined References (152)

PMID Year Title
26707573 2016 Autophagy-associated proteins BAG3 and p62 in testicular cancer.
26655271 2016 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10.
26621836 2016 BAG3 elevation inhibits cell proliferation via direct interaction with G6PD in hepatocellular carcinomas.
26545904 2015 BAG3-related myopathy, polyneuropathy and cardiomyopathy with long QT syndrome.
26541455 2015 MiR-143 enhances the antitumor activity of shikonin by targeting BAG3 expression in human glioblastoma stem cells.
26522614 2015 BAG3 promotes pancreatic ductal adenocarcinoma growth by activating stromal macrophages.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26496431 2015 A Role for the Chaperone Complex BAG3-HSPB8 in Actin Dynamics, Spindle Orientation and Proper Chromosome Segregation during Mitosis.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
26159920 2015 BAG3 affects the nucleocytoplasmic shuttling of HSF1 upon heat stress.
More...