Property Summary

NCBI Gene PubMed Count 169
PubMed Score 208.85
PubTator Score 147.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cardiomyopathy 116 4.263 2.1
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Myopathy 185 3.944 2.0
Disease Target Count Z-score Confidence
Cancer 2499 3.494 1.7

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.319 1.3e-02
active ulcerative colitis 1.270 1.6e-02
astrocytoma 2.000 6.4e-03
esophageal adenocarcinoma -1.200 2.3e-02
group 3 medulloblastoma -1.300 6.1e-03
lung cancer -1.900 1.4e-05
lung carcinoma -1.200 2.6e-15
medulloblastoma, large-cell -2.600 1.6e-03
osteosarcoma 2.219 7.8e-05
ovarian cancer -1.600 1.5e-06
pituitary cancer -2.500 4.0e-07
primitive neuroectodermal tumor -1.100 6.4e-03
psoriasis 1.700 5.0e-04
spina bifida -1.019 3.8e-02

 GWAS Trait (1)

Gene RIF (140)

AA Sequence

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPS      1 - 70
REGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRG     71 - 140
MPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPV    141 - 210
IHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP    211 - 280
ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKP    281 - 350
VSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP    351 - 420
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTI    421 - 490
LEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS    491 - 560
NPSSMTDTPGNPAAP                                                           561 - 575
//

Text Mined References (179)

PMID Year Title