Property Summary

NCBI Gene PubMed Count 20
PubMed Score 194.43
PubTator Score 30.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 9.8e-09
medulloblastoma, large-cell 6241 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Astigmatism 54 5.133 2.6
Myopia 176 3.622 1.8
Chromosome 9p deletion syndrome 13 3.426 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.1e-04
ovarian cancer 1.200 9.8e-09

Gene RIF (10)

AA Sequence

MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVATSPAG      1 - 70
EGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFR     71 - 140
KTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCL    141 - 210
PAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSA                 211 - 267
//

Text Mined References (20)

PMID Year Title