Property Summary

NCBI Gene PubMed Count 24
Grant Count 95
R01 Count 64
Funding $26,975,639.06
PubMed Score 628.58
PubTator Score 191.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O95810
Symbols SDR
CAVIN2
PS-p68
cavin-2

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
26739564 identification of a novel metastasis suppressor gene, serum deprivation response (SDPR), localized to 2q32-33, a region reported to be associated with significant loss of heterozygosity in breast cancer, is reported.
26086560 Cavin-1 and cavin-2 are strongly expressed within caveolae-like structures within liver sinusoidal endothelial cells of the hepatitis C-related cirrhotic liver and cavin-1 would play a critical role in regulating aspects of caveolin-1.
25124890 Three genes (LY96, IL8 DPR) were significantly downregulated over time. This finding was confirmed in a validation cohort of stroke patients (n=8).
24473072 Rather than forming a single coat complex containing the three cavin family members, single-molecule analysis reveals an exquisite specificity of interactions between cavin1, cavin2 and cavin3.
21913217 The cavin family protein Polymerase 1 and transcript release factor, SRBC and serum deprivation response protein were down regulated in breast cancer cell lines and breast tumor tissue.
19525939 Study conclude that SDPR is a membrane-curvature-inducing component of caveolae, and that STB-induced membrane tubulation is facilitated by caveolae.

AA Sequence

MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLD      1 - 70
AVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVK     71 - 140
RLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPH    141 - 210
DEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQ    211 - 280
KISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGE    281 - 350
IAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ    351 - 420
VHQTS                                                                     421 - 425
//

Text Mined References (28)

PMID Year Title
26739564 2016 SDPR functions as a metastasis suppressor in breast cancer by promoting apoptosis.
26086560 2015 Increases in endothelial caveolin-1 and cavins correlate with cirrhosis progression.
25416956 2014 A proteome-scale map of the human interactome network.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25124890 2015 A genomic profile of the immune response to stroke with implications for stroke recovery.
24473072 2013 Single-molecule analysis reveals self assembly and nanoscale segregation of two distinct cavin subcomplexes on caveolae.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21913217 2012 Down-regulation of the cavin family proteins in breast cancer.
19722192 2009 Proteomic identification of pleckstrin-associated proteins in platelets: possible interactions with actin.
More...