Property Summary

NCBI Gene PubMed Count 31
PubMed Score 685.39
PubTator Score 191.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
acute myeloid leukemia -1.300 2.2e-02
adult high grade glioma -1.900 2.3e-07
aldosterone-producing adenoma -1.185 3.8e-02
Atopic dermatitis -1.600 2.3e-03
atypical teratoid / rhabdoid tumor -1.400 6.9e-03
Breast cancer -3.000 4.1e-02
breast carcinoma -1.700 8.5e-27
chronic rhinosinusitis -1.810 8.7e-03
colon cancer -2.200 1.2e-06
cystic fibrosis -1.302 1.4e-03
ductal carcinoma in situ -2.600 1.6e-05
gastric cancer 1.300 1.6e-02
glioblastoma -1.200 5.2e-05
group 4 medulloblastoma -1.600 6.6e-06
hepatocellular carcinoma 1.300 2.9e-03
intraductal papillary-mucinous adenoma (... -1.300 3.2e-04
intraductal papillary-mucinous carcinoma... -1.200 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.100 4.1e-03
invasive ductal carcinoma -2.500 2.4e-04
lung adenocarcinoma -2.200 7.9e-19
lung cancer -1.700 1.4e-04
lung carcinoma -2.900 6.2e-24
malignant mesothelioma -2.300 2.7e-06
medulloblastoma, large-cell -1.800 2.2e-05
nephrosclerosis 1.231 3.5e-04
non-small cell lung cancer -3.028 5.5e-25
osteosarcoma -3.249 1.2e-02
ovarian cancer -1.100 1.3e-08
pancreatic cancer 2.100 1.8e-03
pancreatic carcinoma 2.100 1.8e-03
pancreatic ductal adenocarcinoma liver m... -2.175 1.1e-03
psoriasis -1.700 2.6e-08

Gene RIF (10)

AA Sequence

MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLD      1 - 70
AVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVK     71 - 140
RLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPH    141 - 210
DEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQ    211 - 280
KISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGE    281 - 350
IAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ    351 - 420
VHQTS                                                                     421 - 425
//

Text Mined References (36)

PMID Year Title