Property Summary

NCBI Gene PubMed Count 24
PubMed Score 628.58
PubTator Score 191.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.26673255452329E-39
non-small cell lung cancer 2798 1.23241326514917E-30
lung carcinoma 2844 6.21022488952032E-24
lung adenocarcinoma 2714 6.71356396629081E-21
ovarian cancer 8492 1.24150194384343E-12
psoriasis 6685 2.59510513390695E-8
adult high grade glioma 2148 2.31455190257729E-7
lung cancer 4473 2.5373960002877E-7
colon cancer 1475 1.21576945306172E-6
malignant mesothelioma 3163 2.68413070385638E-6
medulloblastoma, large-cell 6234 2.86760843144765E-6
ductal carcinoma in situ 1745 2.53928405255719E-5
invasive ductal carcinoma 2950 6.39909824347888E-5
nephrosclerosis 329 3.53785710903761E-4
group 4 medulloblastoma 1875 4.5445819635856E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.76654119056295E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.87942439989959E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00109350757868298
pancreatic carcinoma 567 0.0017810758525944
pancreatic cancer 2300 0.00178107585259441
Atopic dermatitis 944 0.00228941967026343
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00248905239067168
hepatocellular carcinoma 550 0.00286865143595109
atypical teratoid / rhabdoid tumor 4369 0.00296558962476415
glioblastoma 5572 0.00537373952813606
chronic rhinosinusitis 512 0.00865131537163251
gastric cancer 436 0.0111254419046656
osteosarcoma 7933 0.0119485048787998
Breast cancer 3099 0.0215510499526643
acute myeloid leukemia 785 0.0218885989799488
cystic fibrosis and chronic rhinosinusitis 213 0.029644041629957
aldosterone-producing adenoma 664 0.0376762380287711
Disease Target Count Z-score Confidence
Cerebral palsy 28 3.392 1.7

Expression

Synonym

Accession O95810
Symbols SDR
CAVIN2
PS-p68
cavin-2

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
26739564 identification of a novel metastasis suppressor gene, serum deprivation response (SDPR), localized to 2q32-33, a region reported to be associated with significant loss of heterozygosity in breast cancer, is reported.
26086560 Cavin-1 and cavin-2 are strongly expressed within caveolae-like structures within liver sinusoidal endothelial cells of the hepatitis C-related cirrhotic liver and cavin-1 would play a critical role in regulating aspects of caveolin-1.
25124890 Three genes (LY96, IL8 DPR) were significantly downregulated over time. This finding was confirmed in a validation cohort of stroke patients (n=8).
24473072 Rather than forming a single coat complex containing the three cavin family members, single-molecule analysis reveals an exquisite specificity of interactions between cavin1, cavin2 and cavin3.
21913217 The cavin family protein Polymerase 1 and transcript release factor, SRBC and serum deprivation response protein were down regulated in breast cancer cell lines and breast tumor tissue.
19525939 Study conclude that SDPR is a membrane-curvature-inducing component of caveolae, and that STB-induced membrane tubulation is facilitated by caveolae.

AA Sequence

MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLD      1 - 70
AVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVK     71 - 140
RLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPH    141 - 210
DEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQ    211 - 280
KISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGE    281 - 350
IAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ    351 - 420
VHQTS                                                                     421 - 425
//

Text Mined References (28)

PMID Year Title
26739564 2016 SDPR functions as a metastasis suppressor in breast cancer by promoting apoptosis.
26086560 2015 Increases in endothelial caveolin-1 and cavins correlate with cirrhosis progression.
25416956 2014 A proteome-scale map of the human interactome network.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25124890 2015 A genomic profile of the immune response to stroke with implications for stroke recovery.
24473072 2013 Single-molecule analysis reveals self assembly and nanoscale segregation of two distinct cavin subcomplexes on caveolae.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21913217 2012 Down-regulation of the cavin family proteins in breast cancer.
19722192 2009 Proteomic identification of pleckstrin-associated proteins in platelets: possible interactions with actin.
More...