Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.47
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.66054945442616E-13
acute quadriplegic myopathy 1157 1.07043301761931E-5
ovarian cancer 8492 4.47947645957145E-4
pancreatic cancer 2300 0.00221496176800485
primary pancreatic ductal adenocarcinoma 1271 0.00229409091769772
lung cancer 4473 0.00337438458807987
Multiple myeloma 1328 0.00445747979543299
ependymoma 2514 0.0313007969863688

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.103 0.004
ependymoma -1.100 0.031
juvenile dermatomyositis 1.501 0.000
acute quadriplegic myopathy 1.073 0.000
primary pancreatic ductal adenocarcinoma 1.268 0.002
lung cancer -1.300 0.003
ovarian cancer 2.100 0.000
pancreatic cancer 1.300 0.002

Synonym

Accession O95807
Symbols SMP1
IFNRC

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

AA Sequence

MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMI      1 - 70
NAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFI     71 - 140
FFGGLVFKFGRTEDLWQ                                                         141 - 157
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
16381901 2006 The LIFEdb database in 2006.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...