Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.47
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.073 1.1e-05
ependymoma -1.100 3.1e-02
juvenile dermatomyositis 1.501 4.7e-13
lung cancer -1.300 3.4e-03
Multiple myeloma 1.103 4.5e-03
ovarian cancer -1.700 3.4e-07
pancreatic cancer 1.300 2.2e-03
primary pancreatic ductal adenocarcinoma 1.268 2.3e-03

AA Sequence

MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMI      1 - 70
NAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFI     71 - 140
FFGGLVFKFGRTEDLWQ                                                         141 - 157
//

Text Mined References (17)

PMID Year Title