Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
R01 Count 1
Funding $287,488
PubMed Score 1.47
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.103 0.004
ependymoma -1.100 0.031
juvenile dermatomyositis 1.501 0.000
acute quadriplegic myopathy 1.073 0.000
primary pancreatic ductal adenocarcinoma 1.268 0.002
lung cancer -1.300 0.003
ovarian cancer 2.100 0.000
pancreatic cancer 1.300 0.002

AA Sequence

MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMI      1 - 70
NAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFI     71 - 140
FFGGLVFKFGRTEDLWQ                                                         141 - 157
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
16381901 2006 The LIFEdb database in 2006.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...