Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
R01 Count 3
Funding $68,725.75
PubMed Score 5.07
PubTator Score 16.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.700 0.000
oligodendroglioma -1.200 0.028
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.800 0.001
group 4 medulloblastoma -1.800 0.001
pilocytic astrocytoma -2.200 0.000
lung carcinoma 2.800 0.000

Synonym

Accession O95803 B4DI67 Q4W5C1 Q4W5D0 Q6UWC5 Q9UP21
Symbols HSST3

Gene

Gene RIF (6)

PMID Text
26731438 A genome-wide association study provided suggestive evidence that the NDST3 variation predisposed patients to schizophrenia and bipolar disorder.
25139529 study provides evidence that the minor allele of rs11098403, an SNP near NDST3, is significantly associated with a reduced risk of schizophrenia in a Han Chinese population, further confirming the data obtained from Caucasians
24253340 A case-control study evaluating the entire genome for genes associated with the risk of schizophrenia and bipolar disorder demnstrated polymorphisms of NDST3 in case patients.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFIMKLHRHFQRTVILLATFCMVSIIISAYYLYSGYKQENELSETASEVDCGDLQHLPYQLMEVKAMKL      1 - 70
FDASRTDPTVLVFVESQYSSLGQDIIMILESSRFQYHIEIAPGKGDLPVLIDKMKGKYILIIYENILKYI     71 - 140
NMDSWNRSLLDKYCVEYGVGVIGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKL    141 - 210
EKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHDGIQRVLFGNNLNFWL    211 - 280
HKLIFIDAISFLSGKRLTLSLDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRAQITNFTFNLGFS    281 - 350
GKFYHTGTEEEDEGDDCLLGSVDEFWWFPHMWSHMQPHLFHNESSLVEQMILNKKFALEHGIPTDMGYAV    351 - 420
APHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARYRRGFIHKNIMVLPRQTCGLFTHTIFYKEYP    421 - 490
GGPKELDKSIQGGELFFTVVLNPISIFMTHLSNYGNDRLGLYTFVNLANFVKSWTNLRLQTLPPVQLAHK    491 - 560
YFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALYLFLVMHPSILSNSPSPKT    561 - 630
FEEVQFFNRNNYHRGIDWYMDFFPVPSNVTTDFLFEKSANYFHSEEAPKRAASLVPKAKIITILIDPSDR    631 - 700
AYSWYQHQRSHEDPAALKFSFYEVISAGPRAPSELRALQKRCLVPGWYASHIERWLVYFPPFQLLIIDGQ    701 - 770
QLRTDPATVMDEVQKFLGVLPHYNYSEALTFDSHKGFWCQLLEEGKTKCLGKSKGRKYPPMDSDSRTFLS    771 - 840
SYYRDHNVELSKLLHKLGQPLPSWLRQELQKVR                                         841 - 873
//

Text Mined References (19)

PMID Year Title
26731438 2016 A comprehensive analysis of NDST3 for schizophrenia and bipolar disorder in Han Chinese.
25139529 2014 rs11098403 polymorphism near NDST3 is associated with a reduced risk of schizophrenia in a Han Chinese population.
24253340 2013 Genome-wide association study implicates NDST3 in schizophrenia and bipolar disorder.
21948523 2011 Post-transcriptional exon shuffling events in humans can be evolutionarily conserved and abundant.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
18692483 2008 Glycanogenomics: a qPCR-approach to investigate biological glycan function.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...