Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.78
PubTator Score 16.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.800 1.0e-03
Astrocytoma, Pilocytic -2.200 3.9e-08
atypical teratoid / rhabdoid tumor -1.700 5.3e-06
ependymoma -1.400 3.8e-02
glioblastoma -2.000 8.7e-10
group 3 medulloblastoma -1.500 2.4e-02
lung carcinoma 2.800 4.0e-36
medulloblastoma, large-cell -1.600 4.0e-04
oligodendroglioma -1.200 2.8e-02

Gene RIF (6)

AA Sequence

MSFIMKLHRHFQRTVILLATFCMVSIIISAYYLYSGYKQENELSETASEVDCGDLQHLPYQLMEVKAMKL      1 - 70
FDASRTDPTVLVFVESQYSSLGQDIIMILESSRFQYHIEIAPGKGDLPVLIDKMKGKYILIIYENILKYI     71 - 140
NMDSWNRSLLDKYCVEYGVGVIGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKL    141 - 210
EKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHDGIQRVLFGNNLNFWL    211 - 280
HKLIFIDAISFLSGKRLTLSLDRYILVDIDDIFVGKEGTRMNTNDVKALLDTQNLLRAQITNFTFNLGFS    281 - 350
GKFYHTGTEEEDEGDDCLLGSVDEFWWFPHMWSHMQPHLFHNESSLVEQMILNKKFALEHGIPTDMGYAV    351 - 420
APHHSGVYPVHVQLYEAWKKVWNIKITSTEEYPHLKPARYRRGFIHKNIMVLPRQTCGLFTHTIFYKEYP    421 - 490
GGPKELDKSIQGGELFFTVVLNPISIFMTHLSNYGNDRLGLYTFVNLANFVKSWTNLRLQTLPPVQLAHK    491 - 560
YFELFPDQKDPLWQNPCDDKRHRDIWSKEKTCDRLPKFLVIGPQKTGTTALYLFLVMHPSILSNSPSPKT    561 - 630
FEEVQFFNRNNYHRGIDWYMDFFPVPSNVTTDFLFEKSANYFHSEEAPKRAASLVPKAKIITILIDPSDR    631 - 700
AYSWYQHQRSHEDPAALKFSFYEVISAGPRAPSELRALQKRCLVPGWYASHIERWLVYFPPFQLLIIDGQ    701 - 770
QLRTDPATVMDEVQKFLGVLPHYNYSEALTFDSHKGFWCQLLEEGKTKCLGKSKGRKYPPMDSDSRTFLS    771 - 840
SYYRDHNVELSKLLHKLGQPLPSWLRQELQKVR                                         841 - 873
//

Text Mined References (19)

PMID Year Title