Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.26
PubTator Score 10.59

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPDLACLQSIIFD      1 - 70
EERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSALNDV     71 - 140
TAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQRDVRKANL    141 - 210
KEKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLF    211 - 280
LYPEYAQSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVL    281 - 350
QHQRYFVKALTPAFLVCVGSSPFCKNFLRGRKVYQIR                                     351 - 387
//

Text Mined References (17)

PMID Year Title