Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.02
PubTator Score 2.51

Knowledge Summary

Patent (1,953)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Histoplasmosis 22 3.143 1.6

Expression

Synonym

Accession O95800 B2RC02 Q6NWR2
Symbols GPRchr2
WI31133

Gene

PANTHER Protein Class (2)

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model
Steve Finkbeiner Neurite and survival phenotype identified

AA Sequence

MNSTGHLQDAPNATSLHVPHSQEGNSTSLQEGLQDLIHTATLVTCTFLLAVIFCLGSYGNFIVFLSFFDP      1 - 70
AFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFVLFFSSASSIPDAFCFTFHLTSSGFIIMSLKTVAVIA     71 - 140
LHRLRMVLGKQPNRTASFPCTVLLTLLLWATSFTLATLATLKTSKSHLCLPMSSLIAGKGKAILSLYVVD    141 - 210
FTFCVAVVSVSYIMIAQTLRKNAQVRKCPPVITVDASRPQPFMGVPVQGGGDPIQCAMPALYRNQNYNKL    211 - 280
QHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKAVVTCVIIVLSVLVCCLPLGISLVQVVLSSNG    281 - 350
SFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRN    351 - 420
KSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSP    421 - 490
SQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV                        491 - 540
//

Text Mined References (7)

PMID Year Title
23979485 2013 The novel chemokine receptor, G-protein-coupled receptor 75, is expressed by islets and is coupled to stimulation of insulin secretion and improved glucose homeostasis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11466257 2001 Evaluation of the G protein coupled receptor-75 (GPR75) in age related macular degeneration.
10381362 1999 Cloning and characterization of a novel orphan G-protein-coupled receptor localized to human chromosome 2p16.