Property Summary

NCBI Gene PubMed Count 64
PubMed Score 174.06
PubTator Score 48.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.300 2.7e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
juvenile dermatomyositis 1.027 1.7e-10
lung adenocarcinoma 1.319 5.9e-09
Multiple myeloma 1.269 2.2e-03
osteosarcoma -1.063 1.9e-04
ovarian cancer -1.300 2.7e-03

Gene RIF (46)

AA Sequence

MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES      1 - 70
ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG     71 - 140
KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP    141 - 210
PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE    211 - 280
YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE    281 - 350
ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM    351 - 420
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS    421 - 490
EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS    491 - 560
TEMPRTGNGPMSVCGRC                                                         561 - 577
//

Text Mined References (70)

PMID Year Title