Property Summary

NCBI Gene PubMed Count 59
Grant Count 52
R01 Count 22
Funding $4,329,101.02
PubMed Score 169.18
PubTator Score 48.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.269 0.002
osteosarcoma -1.063 0.000
juvenile dermatomyositis 1.027 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.011
lung adenocarcinoma 1.319 0.000
ovarian cancer 2.900 0.000
dermatomyositis 1.300 0.000

Gene RIF (58)

PMID Text
26824521 together, these data highlight the broad impact of Stau1 as a splicing regulator and suggest that Stau1 may act as a disease modifier in DM1.
25799984 in vivo atlas of mRNA secondary structures recognized by Staufen 1
25749978 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
25620022 The changing pattern of STAU distribution during meiotic maturation of human oocytes implicates a novel mechanism for the regulation of protein synthesis based on mRNA localization
25423178 expression of human Staufen1 is essential for proper dendritic arborisation during neuroblastoma cell differentiation, yet it is not necessary for maintenance of differentiated state, and suggest potential human Stauf1 mRNA targets involved in the process
25066606 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
25066606 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
25010285 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
24470147 A common sequence signature consisting of two opposite-polarity Alu motifs was present in the hStau1-associated mRNAs and was shown to be sufficient for binding to hStau1 and hStau1-dependent stimulation of protein expression.
24056942 STAU1 binding to a 3'-UTR SBS was previously shown to trigger STAU1-mediated mRNA decay (SMD) by directly recruiting the ATP-dependent RNA helicase UPF1
More...

AA Sequence

MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES      1 - 70
ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG     71 - 140
KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP    141 - 210
PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE    211 - 280
YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE    281 - 350
ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM    351 - 420
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS    421 - 490
EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS    491 - 560
TEMPRTGNGPMSVCGRC                                                         561 - 577
//

Publication (65)

PMID Year Title
26824521 2016 Staufen1 Regulates Multiple Alternative Splicing Events either Positively or Negatively in DM1 Indicating Its Role as a Disease Modifier.
25799984 2015 hiCLIP reveals the in vivo atlas of mRNA secondary structures recognized by Staufen 1.
25620022 2015 Expression and intracytoplasmic distribution of staufen and calreticulin in maturing human oocytes.
25423178 2014 Human Staufen1 associates to miRNAs involved in neuronal cell differentiation and is required for correct dendritic formation.
25416956 2014 A proteome-scale map of the human interactome network.
24489884 2014 Genome-wide association study of proneness to anger.
24470147 2014 Functional signature for the recognition of specific target mRNAs by human Staufen1 protein.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24056942 2013 mRNA-mRNA duplexes that autoelicit Staufen1-mediated mRNA decay.
24019000 2013 TINCR, staufen1, and cellular differentiation.
More...