Property Summary

NCBI Gene PubMed Count 284
Grant Count 453
R01 Count 203
Funding $66,082,827.65
PubMed Score 828.29
PubTator Score 539.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis 2.300 0.000
systemic lupus erythematosus 1.200 0.006
hepatocellular carcinoma 1.200 0.008
cutaneous lupus erythematosus 2.200 0.000
osteosarcoma -1.125 0.011
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 1.300 0.008
cystic fibrosis 1.402 0.000
juvenile dermatomyositis 2.757 0.000
Atopic dermatitis 1.100 0.001
tuberculosis 1.200 0.007
intraductal papillary-mucinous neoplasm ... 1.700 0.014
lung cancer -2.200 0.000
interstitial cystitis 1.100 0.011
pediatric high grade glioma 1.100 0.004
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.200 0.003
ovarian cancer -1.500 0.000
dermatomyositis 1.500 0.021

Synonym

Accession O95786 A2RU81 Q5HYE1 Q5VYT1 Q9NT04
Symbols RIGI
RIG-I
RLR-1
SGMRT2

Gene

PDB

2LWD   2LWE   2QFB   2QFD   2RMJ   2YKG   3LRN   3LRR   3NCU   3OG8   3ZD6   3ZD7   4AY2   4BPB   4NQK   4ON9   4P4H   5E3H   5F98   5F9F   5F9H  

Gene RIF (256)

PMID Text
26998762 Data show that the NS3 protein of dengue virus bound to 14-3-3 epsilon protein (14-3-3varepsilon) and prevented translocation of retinoic acid-inducible gene-I protein (RIG-I) to the adaptor MAVS protein and thereby blocked antiviral signaling.
26876165 In cell culture, Marburg virus infection results in a greater upregulation of IFN responses as compared to Ebolavirus infection, which correlates with differences in the efficiencies by which EBOV and MARV VP35s antagonize RIG-I signaling.
26862753 RIG-I subsequently localized to antiviral stress granules induced after viral replication complexes formation
26746851 HDAC6 transiently bound to RIG-I and removed the lysine 909 acetylation in the presence of viral RNAs, promoting RIG-I sensing of viral RNAs.
26612866 RIG-I uses its autoinhibitory CARD2-Hel2i (second CARD-helicase insertion domain) interface as a barrier to select against non-blunt ended double-stranded RNAs.
26609812 ATP hydrolysis displaces wild-type RIG-I from this self-RNA but not from 5' triphosphate dsRNA.
26608320 These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production.
26518362 that miR-4516 mediated down-regulation of UBE2N promotes p53 nuclear translocation and pro-apoptotic activity of PUVA is independent of IRF3 but is mediated by the RIG-I in a p53 and NFkappaB dependent manner
26506431 TRIM21-induced exposure of the viral genome promotes sensing of DNA and RNA viruses by cGAS and RIG-I
26485346 These results showed that mRNA levels of MDA5 and RIG-1 were significantly decreased and increased, respectively, in chronic hepatitis B patients when compared to healthy controls.
More...

AA Sequence

MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWF      1 - 70
RGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEIL     71 - 140
QICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQ    141 - 210
IFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEH    211 - 280
HLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQI    281 - 350
LVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNT    351 - 420
DEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRIC    421 - 490
KDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARM    491 - 560
KDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETIT    561 - 630
ILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVA    631 - 700
DEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQT    701 - 770
WDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKE    771 - 840
CFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKD    841 - 910
FHFEKIPFDPAEMSK                                                           911 - 925
//

Text Mined References (297)

PMID Year Title
26998762 2016 A phosphomimetic-based mechanism of dengue virus to antagonize innate immunity.
26876165 2016 Differential Regulation of Interferon Responses by Ebola and Marburg Virus VP35 Proteins.
26862753 2016 Leader-Containing Uncapped Viral Transcript Activates RIG-I in Antiviral Stress Granules.
26746851 2016 HDAC6 regulates cellular viral RNA sensing by deacetylation of RIG-I.
26612866 2016 The autoinhibitory CARD2-Hel2i Interface of RIG-I governs RNA selection.
26609812 2015 ATP hydrolysis by the viral RNA sensor RIG-I prevents unintentional recognition of self-RNA.
26608320 2015 PACT- and RIG-I-Dependent Activation of Type I Interferon Production by a Defective Interfering RNA Derived from Measles Virus Vaccine.
26518362 2016 Gene expression profiling reveals the role of RIG1 like receptor signaling in p53 dependent apoptosis induced by PUVA in keratinocytes.
26506431 2015 TRIM21 Promotes cGAS and RIG-I Sensing of Viral Genomes during Infection by Antibody-Opsonized Virus.
26485346 2015 Are RIG-1 and MDA5 Expressions Associated with Chronic HBV Infection?
More...