Property Summary

NCBI Gene PubMed Count 49
PubMed Score 2.75
PubTator Score 8.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.97180903964911E-6
glioblastoma 5572 3.64764040294024E-4
atypical teratoid / rhabdoid tumor 4369 4.55595372590356E-4
Pick disease 1893 7.45090382097483E-4
diabetes mellitus 1663 0.00146073387370358
oligodendroglioma 2849 0.00149073818181198
ependymoma 2514 0.00183056532336505
astrocytic glioma 2241 0.00240962128325151
osteosarcoma 7933 0.00244189402203541
subependymal giant cell astrocytoma 2287 0.00587991293601631
Polycystic Ovary Syndrome 335 0.00639354676048799
Rheumatoid Arthritis 1171 0.034766306977591
Disease Target Count Z-score Confidence
Cystadenoma 7 3.497 1.7
Teratocarcinoma 8 3.029 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.900 0.035
astrocytic glioma 1.100 0.002
ependymoma 1.200 0.002
oligodendroglioma 1.200 0.001
osteosarcoma 1.191 0.002
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.000
diabetes mellitus -1.300 0.001
subependymal giant cell astrocytoma -1.799 0.006
Polycystic Ovary Syndrome -1.041 0.006
Pick disease -1.100 0.001
ovarian cancer -3.200 0.000

Synonym

Accession O95782 Q96CI7 Q96PP6 Q96PP7 Q9H070
Symbols ADTAA
CLAPA1
AP2-ALPHA

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (23)

PMID Text
26317613 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
26269175 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
24473078 These results lead to a model for the docking of the full AP-2 tetramer to membranes as bound to Nef, such that the cytosolic tail of CD4 is situated to interact with its binding site on Nef.
24473078 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23705972 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23305486 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23151229 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
23077317 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21762802 HIV-1 Env gp41 requires the conserved membrane-proximal AP2A1 binding site in the gp41 cytoplasmic tail to evade antibody-dependent cell-mediated cytotoxicity (ADCC) via membrane-proximal endocytosis
More...

AA Sequence

MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGH      1 - 70
DIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMCLALHCIANVGS     71 - 140
REMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPMGEWTARVVHLLNDQHMGVVTAAVSL    141 - 210
ITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRL    211 - 280
VECLETVLNKAQEPPKSKKVQHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLAL    281 - 350
ESMCTLASSEFSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI    351 - 420
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAAKTVFEALQAP    421 - 490
ACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRALLLSTYIKFINLFPETKATIQ    491 - 560
GVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLEEMPPFPERESSILAKLKRKKGPGAGSALDD    561 - 630
GRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPE    631 - 700
EAFLSELEPPAPESPMALLADPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFR    701 - 770
QNLGRMYLFYGNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL    771 - 840
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLG    841 - 910
FGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRTSKEPVSRHLCELLAQQF       911 - 977
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24473078 2014 How HIV-1 Nef hijacks the AP-2 clathrin adaptor to downregulate CD4.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24251095 2013 Murine homologue of the human KIAA1199 is implicated in hyaluronan binding and depolymerization.
23509262 2013 KIAA1199, a deafness gene of unknown function, is a new hyaluronan binding protein involved in hyaluronan depolymerization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...