Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.23
PubTator Score 3.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.088 3.2e-04
adult high grade glioma 1.100 2.7e-04
astrocytoma 1.100 1.1e-16
atypical teratoid / rhabdoid tumor 1.100 3.0e-05
breast carcinoma 1.200 1.5e-02
glioblastoma 1.500 1.5e-09
group 3 medulloblastoma 1.600 1.1e-04
lung cancer 1.400 5.1e-04
oligodendroglioma 1.200 2.5e-14
osteosarcoma -1.429 1.7e-02
ovarian cancer 1.100 7.2e-03
pituitary cancer 1.200 1.3e-06
primitive neuroectodermal tumor 1.200 5.9e-04
psoriasis -1.200 1.3e-03

Gene RIF (1)

AA Sequence

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVI      1 - 70
GEIDEETDSALDLGNIRAEPLNSVAH                                                 71 - 96
//

Text Mined References (27)

PMID Year Title