Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.97
PubTator Score 3.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.200 0.001
astrocytoma 1.100 0.000
glioblastoma 1.500 0.000
oligodendroglioma 1.200 0.000
osteosarcoma -1.429 0.017
group 3 medulloblastoma 1.800 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
primitive neuroectodermal tumor 1.200 0.001
adrenocortical carcinoma 1.088 0.000
lung cancer 1.400 0.001
breast carcinoma 1.200 0.015
pediatric high grade glioma 1.400 0.000
ovarian cancer 1.100 0.007
pituitary cancer 1.200 0.000

Synonym

Accession O95777
Symbols NAA38

Gene

PDB

3JCR  

Gene RIF (1)

PMID Text
22875987 LSm8 controls nuclear accumulation of all LSm2-7 proteins and the number of cytoplasmic processing bodies.

AA Sequence

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVI      1 - 70
GEIDEETDSALDLGNIRAEPLNSVAH                                                 71 - 96
//

Text Mined References (26)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22875987 2012 Nuclear LSm8 affects number of cytoplasmic processing bodies via controlling cellular distribution of Like-Sm proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
More...