Property Summary

NCBI Gene PubMed Count 24
PubMed Score 3.92
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 8.5e-09
ovarian cancer 8520 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis 1.131 8.5e-09
ovarian cancer -1.400 1.9e-03

Gene RIF (9)

AA Sequence

MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLW      1 - 70
IIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAK     71 - 140
VILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYS    141 - 210
PPESEAGSEEAEEKQDSEKPLLEL                                                  211 - 234
//

Text Mined References (29)

PMID Year Title