Property Summary

NCBI Gene PubMed Count 357
PubMed Score 870.04
PubTator Score 513.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Immediate hypersensitivity 8
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Asthma 385 5.955 3.0
Endometriosis 540 0.0 1.7

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.327 2.6e-03
adrenocortical carcinoma -1.787 4.0e-05
adult high grade glioma 1.900 3.7e-04
aldosterone-producing adenoma -1.169 9.6e-03
astrocytic glioma 1.400 4.3e-02
Astrocytoma, Pilocytic 1.200 3.5e-03
Breast cancer -2.700 3.4e-02
breast carcinoma -1.900 1.1e-05
ductal carcinoma in situ -1.100 1.5e-02
group 3 medulloblastoma -1.200 2.5e-03
interstitial cystitis 1.600 1.8e-03
invasive ductal carcinoma -3.300 7.4e-04
lung adenocarcinoma -1.800 1.1e-09
lung cancer -2.600 1.4e-04
lung carcinoma -1.900 1.5e-11
malignant mesothelioma -8.200 6.0e-10
medulloblastoma, large-cell -1.500 6.8e-04
mucosa-associated lymphoid tissue lympho... 1.333 3.3e-02
nasopharyngeal carcinoma -1.700 8.5e-03
non-small cell lung cancer -2.991 3.3e-23
osteosarcoma -2.718 1.6e-02
primary Sjogren syndrome 1.500 2.9e-04
subependymal giant cell astrocytoma 3.190 1.4e-02
ulcerative colitis 3.100 7.5e-06

 GO Function (1)

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (350)

AA Sequence

MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSL      1 - 70
KTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALED     71 - 140
ESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEK    141 - 210
PLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET              211 - 270
//

Text Mined References (359)

PMID Year Title