Property Summary

NCBI Gene PubMed Count 283
PubMed Score 721.18
PubTator Score 513.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 1.52701667758853E-46
non-small cell lung cancer 2798 3.27128255501577E-23
lung adenocarcinoma 2714 3.40349515623446E-15
lung carcinoma 2844 1.49240948752394E-11
malignant mesothelioma 3163 6.02036201818616E-10
ulcerative colitis 2087 7.46072992787607E-6
breast carcinoma 1614 1.0969310137062E-5
lung cancer 4473 1.18605138002308E-5
adrenocortical carcinoma 1427 3.95959457409803E-5
primary Sjogren syndrome 789 2.90661436249276E-4
adult high grade glioma 2148 3.66442238831334E-4
medulloblastoma, large-cell 6234 6.79733370741819E-4
invasive ductal carcinoma 2950 7.37770841190053E-4
interstitial cystitis 2299 0.00180987519564623
group 3 medulloblastoma 2254 0.00245505826200776
adrenocortical adenoma 134 0.00255905777134513
pilocytic astrocytoma 3086 0.00284243258190922
nasopharyngeal carcinoma 1056 0.00852083689388742
aldosterone-producing adenoma 664 0.00960095120468808
subependymal giant cell astrocytoma 2287 0.0139726058452263
ductal carcinoma in situ 1745 0.0150757278270621
osteosarcoma 7933 0.0159969194741326
mucosa-associated lymphoid tissue lymphoma 480 0.0326127059757341
astrocytic glioma 2241 0.0431706764424769
Disease Target Count Z-score Confidence
Asthma 349 5.745 2.9
Endometriosis 535 0.0 1.0

Expression

  Differential Expression (24)

Synonym

Accession O95760 B2R8L1 B4DJ35 B4E1Q9 D3DRI5 E7EAX4 Q2YEJ5 IL-33
Symbols DVS27
IL1F11
NF-HEV
NFEHEV
C9orf26

Gene

PDB

4KC3   2KLL  

  Ortholog (8)

 GO Function (1)

 GWAS Trait (1)

Gene RIF (275)

PMID Text
26762527 Our findings indicate that the alarmin cytokines IL-33 and IL-25 increase basophil activation and migratory potential, and may pose as a novel therapeutic targets for the treatment of allergic asthma.
26755704 IL-33(+) Muller cells were more abundant and IL-33 cytokine was elevated in advanced age-related macular degeneration cases compared with age-matched controls.
26679377 The IL-33/ST2 signalling axis may have a protective role in colon carcinogenesis.
26675669 Targeting IL-33 was a promising strategy for controlling autoantibody production in AIHA patients
26610488 IL13 gene transcription can be directly activated by nuclear IL-33, which is negatively regulated by the deubiquitinase USP17.
26571131 No significant association between IL33 rs7025417, IL33 rs7044343, IL1RL1 rs2058660, IL1RL1 rs2310173 and IL1RL1 rs13015714 and cIMT values was observed.
26520876 Data suggest that increased plasma Interleukin-33 (IL-33) levels in patients with rheumatoid arthritis (RA) could be a possible biomarker to reflect the potential risks of bone erosion.
26514775 IL-33 gene expression is associated with pediatric EoE development and that application of recombinant protein in mice phenocopies the early clinical phase of the human disease in an IL-13-dependent manner.
26493291 The G allele of rs928413 was positively associated with atopic asthma in a Chinese population.
26473724 elevated IL-33 and IL-13 were observed in nasal aspirates from infants hospitalized with respiratory syncytial virus; these cytokines declined during convalescence
More...

AA Sequence

MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSL      1 - 70
KTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALED     71 - 140
ESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEK    141 - 210
PLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET              211 - 270
//

Text Mined References (285)

PMID Year Title
27432971 2016 Alternative splicing of interleukin-33 and type 2 inflammation in asthma.
26762527 2016 IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma.
26755704 2016 IL-33 amplifies an innate immune response in the degenerating retina.
26679377 2016 An antitumorigenic role for the IL-33 receptor, ST2L, in colon cancer.
26675669 2015 IL-33 reflects dynamics of disease activity in patients with autoimmune hemolytic anemia by regulating autoantibody production.
26610488 2015 The Deubiquitinase USP17 Regulates the Stability and Nuclear Function of IL-33.
26571131 2015 Protective Role of the Interleukin 33 rs3939286 Gene Polymorphism in the Development of Subclinical Atherosclerosis in Rheumatoid Arthritis Patients.
26520876 2016 Interleukin-33 acts as a transcriptional repressor and extracellular cytokine in fibroblast-like synoviocytes in patients with rheumatoid arthritis.
26514775 2016 Elevated IL-33 expression is associated with pediatric eosinophilic esophagitis, and exogenous IL-33 promotes eosinophilic esophagitis development in mice.
26493291 2015 Polymorphisms of RAD50, IL33 and IL1RL1 are associated with atopic asthma in Chinese population.
More...