Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $203,954.5
PubMed Score 21.70
PubTator Score 18.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26657638 Data show that polypyrimidine tract-binding proteins nPTB and ROD1 interact with mitochondrial tRNA(Thr) in the cytoplasm outside of mitochondria.
25119103 PTBP3 may promote proliferation and inhibit the differentiation of human gastric cancer MKN45 cells
23024754 ROD1 is a bona fide seedless target of miR-210.
22575643 ROD1 and UPF1 associate with a significant number of common transcripts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19441079 Regulator of differentiation 1 (ROD1) binds to the amphipathic C-terminal peptide of thrombospondin-4 and is involved in its mitogenic activity.

AA Sequence

MDGVVTDLITVGLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDV      1 - 70
TEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDN     71 - 140
LPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLK    141 - 210
IITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPT    211 - 280
GDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPG    281 - 350
ASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRL    351 - 420
YGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDD    421 - 490
LKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI            491 - 552
//

Text Mined References (21)

PMID Year Title
26657638 2016 Human polypyrimidine tract-binding protein interacts with mitochondrial tRNA(Thr) in the cytosol.
25119103 2014 The effects of PTBP3 silencing on the proliferation and differentiation of MKN45 human gastric cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024754 2012 ROD1 is a seedless target gene of hypoxia-induced miR-210.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22575643 2012 A new function of ROD1 in nonsense-mediated mRNA decay.
21269460 2011 Initial characterization of the human central proteome.
20937273 2010 MALAT-1 enhances cell motility of lung adenocarcinoma cells by influencing the expression of motility-related genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...