Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.46
PubTator Score 12.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 5.8e-04
astrocytic glioma -2.600 5.1e-03
Astrocytoma, Pilocytic -1.800 8.9e-06
atypical teratoid / rhabdoid tumor -1.500 3.6e-02
Breast cancer -2.100 1.5e-10
glioblastoma -1.500 1.2e-04
lung cancer 1.500 1.5e-02
lung carcinoma 2.500 6.0e-16
medulloblastoma -1.500 1.2e-03
medulloblastoma, large-cell -2.000 2.1e-06
non-small cell lung cancer 1.496 1.7e-12
Pick disease -1.400 3.8e-03
primitive neuroectodermal tumor -1.200 3.3e-03
psoriasis 1.600 1.4e-08

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFKKL      1 - 70
HGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADC     71 - 140
VISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRNVVFIDMGHSAYQV    141 - 210
LVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSAN    211 - 280
ASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIEIVGGATRIPAV    281 - 350
KEQITKFFLKDISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSITLRWKTSFEDGSGECEVF    351 - 420
CKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDARIGSFTIQNVFPQSDGDSSKVKVKVRVNIHGIF    421 - 490
SVASASVIEKQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSA    491 - 560
VSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSYIENEGKMIMQDKLEKERNDAKNAVEEYVYD    561 - 630
FRDRLGTVYEKFITPEDLSKLSAVLEDTENWLYEDGEDQPKQVYVDKLQELKKYGQPIQMKYMEHEERPK    631 - 700
ALNDLGKKIQLVMKVIEAYRNKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSE    701 - 770
IVAKSKELDNFCNPIIYKPKPKAEVPEDKPKANSEHNGPMDGQSGTETKSDSTKDSSQHTKSSGEMEVD     771 - 839
//

Text Mined References (20)

PMID Year Title