Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 7
Funding $890,211.5
PubMed Score 11.15
PubTator Score 12.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.600 0.005
psoriasis 1.600 0.000
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -1.500 0.036
medulloblastoma -1.500 0.001
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.200 0.003
non-small cell lung cancer 1.496 0.000
lung cancer 1.500 0.015
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.800 0.000
lung carcinoma 2.500 0.000
Pick disease -1.400 0.004
Breast cancer -2.100 0.000

Gene RIF (6)

PMID Text
26486082 Findings indicate that miR-497 is a potent tumor suppressor that inhibits cancer phenotypes by targeting ANLN and HSPA4L in NPC.
24091676 HSP40 and HSP110 function together in protein homeostasis control.
23509252 Human molecular chaperone Hsp110 rescues a vesicle transport defect produced by an ALS-associated mutant SOD1 protein in squid axoplasm.
21946539 Expression of a mutant HSP110 sensitizes colorectal cancer cells to chemotherapy and improves disease prognosis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
12952923 a novel autocrine pathway of CD1d regulation by Hsp110.

AA Sequence

MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFKKL      1 - 70
HGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENALKKPVADC     71 - 140
VISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPPLDEKPRNVVFIDMGHSAYQV    141 - 210
LVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSAN    211 - 280
ASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIEIVGGATRIPAV    281 - 350
KEQITKFFLKDISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSITLRWKTSFEDGSGECEVF    351 - 420
CKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDARIGSFTIQNVFPQSDGDSSKVKVKVRVNIHGIF    421 - 490
SVASASVIEKQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSA    491 - 560
VSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSYIENEGKMIMQDKLEKERNDAKNAVEEYVYD    561 - 630
FRDRLGTVYEKFITPEDLSKLSAVLEDTENWLYEDGEDQPKQVYVDKLQELKKYGQPIQMKYMEHEERPK    631 - 700
ALNDLGKKIQLVMKVIEAYRNKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSE    701 - 770
IVAKSKELDNFCNPIIYKPKPKAEVPEDKPKANSEHNGPMDGQSGTETKSDSTKDSSQHTKSSGEMEVD     771 - 839
//

Text Mined References (20)

PMID Year Title
26486082 2015 The potent tumor suppressor miR-497 inhibits cancer phenotypes in nasopharyngeal carcinoma by targeting ANLN and HSPA4L.
24091676 2013 Suppression of polyglutamine protein toxicity by co-expression of a heat-shock protein 40 and a heat-shock protein 110.
23509252 2013 Molecular chaperone Hsp110 rescues a vesicle transport defect produced by an ALS-associated mutant SOD1 protein in squid axoplasm.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21946539 2011 Expression of a mutant HSP110 sensitizes colorectal cancer cells to chemotherapy and improves disease prognosis.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19169850 2009 Molecular cloning of OSP94: A significant biomarker protein of hypertensive human heart and a member of HSP110 family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...