Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.97
PubTator Score 5.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
posterior fossa group B ependymoma 1.900 0.000
group 3 medulloblastoma -1.100 0.003

Synonym

Accession O95755 Q2M390 Q7Z4A9 Q9UHP5
Symbols

Gene

Gene RIF (2)

PMID Text
22637480 These data show that RUTBC2 can act as a Rab36 GAP in cells and suggest that RUTBC2 links Rab9A function to Rab36 function in the endosomal system.
19961360 Rab36 may regulate the spatial distribution of late endosomes and lysosomes through a similar mechanism to Rab34.

AA Sequence

MVIAGASWMLGRAAASPTQTPPTTSTIRVARRSRVALVAMVIAAAGSGGPGRAEPQLSQPSLDCGRMRSS      1 - 70
LTPLGPPVSRDRVIASFPKWYTPEACLQLREHFHGQVSAACQRRNTGTVGLKLSKVVVVGDLYVGKTSLI     71 - 140
HRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQT    141 - 210
LEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFF    211 - 280
SRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC                     281 - 333
//

Text Mined References (11)

PMID Year Title
22637480 2012 RUTBC2 protein, a Rab9A effector and GTPase-activating protein for Rab36.
19961360 2010 Rab36 regulates the spatial distribution of late endosomes and lysosomes through a similar mechanism to Rab34.
16021519 2005 A two-dimensional electrophoresis reference map of human ovary.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10607907 2000 Isolation of genes from the rhabdoid tumor deletion region in chromosome band 22q11.2.
10591208 1999 The DNA sequence of human chromosome 22.
9920784 1999 Cloning and characterization of a novel Rab-family gene, Rab36, within the region at 22q11.2 that is homozygously deleted in malignant rhabdoid tumors.
More...