Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.97
PubTator Score 5.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 1.8e-10
malignant mesothelioma 3232 1.9e-07
group 3 medulloblastoma 4104 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Early myoclonic encephalopathy 15 3.451 1.7
Rhabdoid cancer 5 3.185 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.600 1.8e-10
group 3 medulloblastoma -1.100 3.0e-03
malignant mesothelioma -1.800 1.9e-07

Gene RIF (2)

AA Sequence

MVIAGASWMLGRAAASPTQTPPTTSTIRVARRSRVALVAMVIAAAGSGGPGRAEPQLSQPSLDCGRMRSS      1 - 70
LTPLGPPVSRDRVIASFPKWYTPEACLQLREHFHGQVSAACQRRNTGTVGLKLSKVVVVGDLYVGKTSLI     71 - 140
HRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQT    141 - 210
LEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFF    211 - 280
SRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC                     281 - 333
//

Text Mined References (11)

PMID Year Title