Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.19
PubTator Score 17.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 2.5e-04
atypical teratoid / rhabdoid tumor -1.300 6.1e-04
Breast cancer 2.400 2.6e-02
ependymoma -1.600 2.3e-02
glioblastoma -1.100 2.8e-05
group 3 medulloblastoma -2.100 2.3e-04
intraductal papillary-mucinous carcinoma... -1.600 2.1e-03
lung carcinoma 1.300 3.5e-21
malignant mesothelioma -2.900 1.2e-08
medulloblastoma, large-cell -1.600 4.3e-02
subependymal giant cell astrocytoma -1.724 1.6e-02

Synonym

Accession O95751 Q6IAR6
Symbols Mar7
RTL7
BCUR1
Mart7
SIRH7

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (14)

AA Sequence

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ      1 - 70
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE     71 - 140
EEEDDY                                                                    141 - 146
//

Text Mined References (28)

PMID Year Title