Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
Funding $262,160.29
PubMed Score 19.03
PubTator Score 17.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26637328 LDOC1 inhibits proliferation and promotes apoptosis by repressing NF-kappaB activation in papillary thyroid carcinoma
26317789 Cigarette smoke-induced promoter methylation may contribute to LDOC1 downregulation, thereby conferring oncogenic features to oral cells.
24125169 Silencing of LDOC1 is a frequent event in cervical cancer and may be of interest as a molecular marker in cervical cancer.
23775301 It has potential roles in apoptosis of well differentiated carcinoma without metastases and in neurodegeneration of Alzheimer's disease.
23362108 Silencing of BEX1 and LDOC1 by promoter hypermethylation might represent a critical event in the molecular pathogenesis of oral squamous cell carcinoma (OSCC) and the male predominance of OSCC occurrence.
22546831 The aim of this study was to evaluate the possible differential expression of LDOC1 mRNA in leucocytes of peripheral blood of Down's syndrome subjects. compared with the normal population.
21986234 Letter/Case Report: LDOC1/PARP1 are down-regulated in melanoma with repeated in-transit metastases.
21547351 Over expression of LDOC1 may explain the clinical manifestation found in patients with cryptochidism and Digeorge anomaly.
21310924 LDOC1 is dramatically down-regulated in mutated chronic lymphocytic leukemia cases compared with unmutated cases, and have identified a new splice variant, LDOC1S
15670815 MZF-1 was revealed to interact with LDOC1 and enhance the activity of LDOC1 for inducing apoptosis
More...

AA Sequence

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ      1 - 70
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE     71 - 140
EEEDDY                                                                    141 - 146
//

Text Mined References (22)

PMID Year Title
26637328 2015 LDOC1 inhibits proliferation and promotes apoptosis by repressing NF-?B activation in papillary thyroid carcinoma.
26317789 2015 LDOC1 silenced by cigarette exposure and involved in oral neoplastic transformation.
25416956 2014 A proteome-scale map of the human interactome network.
24125169 2013 Loss of LDOC1 expression by promoter methylation in cervical cancer cells.
23775301 2013 CASP3 and LDOC-1 gene expression in a patient with carcinoma in the hairy part of the head skin and Alzheimer disease.
23362108 2013 Epigenetic regulation of the X-linked tumour suppressors BEX1 and LDOC1 in oral squamous cell carcinoma.
22546831 2012 Expression of LDOC1 mRNA in leucocytes of patients with Down's syndrome.
21986234 2012 Two proapoptotic genes are downregulated in a patient with melanoma and repeated in-transit metastases.
21547351 2011 Over expression of LDOC1 and PARP1, two pro-apoptotic genes, in a patient with cryptorchidism and DiGeorge anomaly.
21310924 2011 LDOC1 mRNA is differentially expressed in chronic lymphocytic leukemia and predicts overall survival in untreated patients.
More...