Property Summary

NCBI Gene PubMed Count 89
PubMed Score 334.21
PubTator Score 162.78

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (72)

AA Sequence

MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC      1 - 70
ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR     71 - 140
LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR    141 - 210
SPSFEK                                                                    211 - 216
//

Text Mined References (91)

PMID Year Title