Property Summary

NCBI Gene PubMed Count 79
Grant Count 62
R01 Count 45
Funding $4,121,384.24
PubMed Score 290.49
PubTator Score 162.78

Knowledge Summary

Patent

No data available

Synonym

Accession O95750 FGF-19
Symbols

Gene

PANTHER Protein Class (2)

PDB

1PWA   2P23  

Gene RIF (62)

PMID Text
26723851 we suggest that considerable mechanistic differences exist between humans and mice with regard to the nuclear receptors controlling the VitA-FGF15/19 axis.
26567701 discusses current knowledge of the complex biology of the endocrine FGFs.
26343925 FGF-19 increment after OGL was positively associated with age, and negatively associated with abnormal glucose regulation and statin treatment
26323668 Study shows that FGF19 can be secreted and promotes ovarian cancer progression such as proliferation and invasion by activating FGFR4.
26293907 FGF19 correlates with severity of liver disease and can potentially serve as an indicator of chronic cholestatic liver injury.
26256900 Suggest a potential connection between gallbladder cholangiocyte-derived FGF19 and bile acid metabolism that could lead to metabolic dysregulation following cholecystectomy.
26152288 KL methylation is a characteristic of many breast cancer cases . However, the resulting or associated perturbation in FGFR4 expression, similar to FGF19, could be utilized as a biomarker for poor prognosis
26028580 In mice with humanized livers, expression of an FGF19 transgene corrects bile acid signaling defects, resulting in normalization of bile acid synthesis, the bile acid pool, and liver size.
25854696 Fibroblast growth factor 19 might be associated with biochemical recurrence after radical prostatectomy by promoting cell proliferation and epithelial-mesenchymal transition of prostate cancer
25664662 The data suggest that FGF19/FGF21 circulating levels and hepatic gene expression of the associated signaling pathway are significantly dysregulated in type 2 diabetes.
More...

AA Sequence

MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC      1 - 70
ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR     71 - 140
LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR    141 - 210
SPSFEK                                                                    211 - 216
//

Text Mined References (81)

PMID Year Title
26723851 2016 Farnesoid X receptor-dependent and -independent pathways mediate the transcriptional control of human fibroblast growth factor 19 by vitamin A.
26567701 2016 Therapeutic potential of the endocrine fibroblast growth factors FGF19, FGF21 and FGF23.
26343925 2015 Factors associated with fibroblast growth factor 19 increment after oral glucose loading in patients who were previously admitted for coronary angiography.
26323668 2015 Fibroblast growth factor 19 is correlated with an unfavorable prognosis and promotes progression by activating fibroblast growth factor receptor 4 in advanced-stage serous ovarian cancer.
26293907 2015 Expression of hepatic Fibroblast Growth Factor 19 is enhanced in Primary Biliary Cirrhosis and correlates with severity of the disease.
26256900 Effect of cholecystectomy on bile acid synthesis and circulating levels of fibroblast growth factor 19.
26152288 2015 Frequent methylation of the KLOTHO gene and overexpression of the FGFR4 receptor in invasive ductal carcinoma of the breast.
26028580 2015 Fibroblast Growth Factor Signaling Controls Liver Size in Mice With Humanized Livers.
25854696 2015 FGF19 promotes progression of prostate cancer.
25664662 2015 Perturbations of fibroblast growth factors 19 and 21 in type 2 diabetes.
More...