Property Summary

NCBI Gene PubMed Count 21
Grant Count 18
R01 Count 13
Funding $2,060,119.68
PubMed Score 178.10
PubTator Score 38.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
24716791 GGPPS1 may play a critical role during the development of HCC from cirrhosis and is of clinical significance for predicting biological character of HCC.
23478574 Egr-1 most likely does not induce the constitutive activation of Erk1/2 through its target gene GGPS1.
21321112 the Egr-1/GGPPS/Erk1/2 pathway is responsible for insulin resistance during hyperinsulinism
21224049 these results reveal a new EGR-1/GGPPS/MAPK signaling pathway that controls cigarette smoke-induced pulmonary inflammation.
20191015 Study suggested that GGPS1 -8188A ins/del polymorphism may confer susceptibility to femoral neck BMD response to bisphosphonate therapy in Korean women.
20191015 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17646172 results indicate that the active form of GGPS in the solution is an octamer rather than hexamer or dimer
17536018 Farnesyltranstransferase mutations are associated with lonafarnib resistance
16698791 crystal structure; it reveals that three dimers join together to form a propeller-bladed hexameric molecule with a mass of approximately 200 kDa
8419360 Evidence for a non-membrane bound isoform of geranylgeranyl diphosphate synthase 1 in rat.

AA Sequence

MEKTQETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNS      1 - 70
KLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPT     71 - 140
EEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTE    141 - 210
GKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGG    211 - 280
NPELVALVKHLSKMFKEENE                                                      281 - 300
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24716791 2014 GGPPS1 predicts the biological character of hepatocellular carcinoma in patients with cirrhosis.
23478574 2013 Egr-1 enhances drug resistance of breast cancer by modulating MDR1 expression in a GGPPS-independent manner.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21321112 2011 An early response transcription factor, Egr-1, enhances insulin resistance in type 2 diabetes with chronic hyperinsulinism.
21269460 2011 Initial characterization of the human central proteome.
21224049 2011 Cigarette smoke-induced pulmonary inflammatory responses are mediated by EGR-1/GGPPS/MAPK signaling.
20191015 2010 Genetic polymorphism of geranylgeranyl diphosphate synthase (GGSP1) predicts bone density response to bisphosphonate therapy in Korean women.
18726356 2000 cDNA cloning, chromosome mapping and expression characterization of human geranylgeranyl pyrophosphate synthase.
17646172 2007 Human geranylgeranyl diphosphate synthase is an octamer in solution.
More...