Property Summary

Ligand Count 37
NCBI Gene PubMed Count 22
PubMed Score 189.98
PubTator Score 38.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MEKTQETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNS      1 - 70
KLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPT     71 - 140
EEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTE    141 - 210
GKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGG    211 - 280
NPELVALVKHLSKMFKEENE                                                      281 - 300
//

Text Mined References (25)

PMID Year Title