Property Summary

NCBI Gene PubMed Count 30
Grant Count 4
R01 Count 4
Funding $229,778.75
PubMed Score 9.38
PubTator Score 7.35

Knowledge Summary

Patent (3,270)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -1.565 0.000
intraductal papillary-mucinous neoplasm ... 2.200 0.001
group 3 medulloblastoma 1.300 0.002

Synonym

Accession O95747 Q3LR53 Q7Z501 Q9UPQ1
Symbols OSR1

Gene

PDB

2V3S   2VWI   3DAK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (15)

PMID Text
24393035 the WNK-regulated SPAK/OSR1 kinases directly phosphorylate the N[K]CCs and KCCs, promoting their stimulation and inhibition respectively.
23034389 SPAK and OSR1, which are often coexpressed in cells, can form functional heterodimers.
22989884 Data show that intracellular association between WNK1 and oxidative stress-responsive 1 (OSR1) is required for stimulation of OSR1 and Na(+), K(+), Cl(-)-Cotransporter NKCC1 and NKCC2 activities by osmotic stress.
20889219 Observational study of gene-disease association. (HuGE Navigator)
20819979 OXSR1 and WNK3 transcripts were substantially overexpressed in subjects with schizophrenia relative to comparison subjects.
19177573 crystal structure of OSR1 kinase domain has been solved at 2.25 A; OSR1 forms a domain-swapped dimer in an inactive conformation, in which P+1 loop and alphaEF helix are swapped between dimer-related monomers
18831043 The first crystal structure of an OSR1 fragment encompassing the catalytic domain of the enzyme, is reported.
18270262 The WNK1-SPAK/OSR1 signalling pathway plays a key role in controlling the phosphorylation and activity of NCC.
17721439 These results provide the first molecular insight into the mechanism by which the SPAK and OSR1 kinases specifically recognize their upstream activators and downstream substrates.
16832045 OSR1 and sterile20-related, proline-, alanine-rich kinase are likely links between WNK lysine deficient protein kinase 1 and solute carrier family 12 in a pathway that contributes to volume regulation and blood pressure homeostasis in mammals
More...

AA Sequence

MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQC      1 - 70
HHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKN     71 - 140
GQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI    141 - 210
WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRP    211 - 280
TAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG    281 - 350
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA    351 - 420
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIV    421 - 490
EEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS                                     491 - 527
//

Text Mined References (43)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24393035 2014 The WNK-regulated SPAK/OSR1 kinases directly phosphorylate and inhibit the K+-Cl- co-transporters.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034389 2012 Calcium-binding protein 39 facilitates molecular interaction between Ste20p proline alanine-rich kinase and oxidative stress response 1 monomers.
22989884 2012 Interactions with WNK (with no lysine) family members regulate oxidative stress response 1 and ion co-transporter activity.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...