Property Summary

NCBI Gene PubMed Count 30
PubMed Score 9.44
PubTator Score 7.35

Knowledge Summary

Patent (3,270)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hypertension 396 3.091 1.5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pseudohypoaldosteronism 23 4.399 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.5e-03
intraductal papillary-mucinous neoplasm ... 2.200 8.5e-04
osteosarcoma -1.565 9.5e-06
psoriasis -2.400 5.4e-05

Gene RIF (15)

AA Sequence

MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQC      1 - 70
HHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKN     71 - 140
GQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI    141 - 210
WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRP    211 - 280
TAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG    281 - 350
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA    351 - 420
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIV    421 - 490
EEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS                                     491 - 527
//

Text Mined References (43)

PMID Year Title