Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession O95744
Symbols PMS4
PMS2L2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGESSRKPPTPTPEGPTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKL      1 - 70
TEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAGATNIDLKLKDYGMDLIEVSGNGCGVEEE     71 - 140
NFEGLSLSALKHHTSKIREFADLTRVETFGFQGKALSSLCALSDVTISTCHVSAKVGTRLVFDHDGKIIK    141 - 210
KTPYPHPRGTTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTVTGEL    211 - 280
RACRSWKTREGITEAVG                                                         281 - 297
//

Text Mined References (6)

PMID Year Title