Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession O95744
Symbols PMS4
PMS2L2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGESSRKPPTPTPEGPTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKL      1 - 70
TEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAGATNIDLKLKDYGMDLIEVSGNGCGVEEE     71 - 140
NFEGLSLSALKHHTSKIREFADLTRVETFGFQGKALSSLCALSDVTISTCHVSAKVGTRLVFDHDGKIIK    141 - 210
KTPYPHPRGTTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTVTGEL    211 - 280
RACRSWKTREGITEAVG                                                         281 - 297
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10101297 1999 The human PMS2L proteins do not interact with hMLH1, a major DNA mismatch repair protein.
9847074 1998 Toward a complete human genome sequence.
8586419 1995 Genomic organization of the human PMS2 gene family.
7980603 1994 Cloning, characterization and chromosomal assignment of the human genes homologous to yeast PMS1, a member of mismatch repair genes.