Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.43
PubTator Score 3.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.300 8.3e-06
astrocytic glioma -2.000 3.3e-03
Astrocytoma, Pilocytic -3.500 1.7e-11
atypical teratoid / rhabdoid tumor -3.700 2.1e-13
ependymoma -1.200 4.5e-02
glioblastoma -3.200 3.7e-11
group 4 medulloblastoma -2.900 3.7e-06
medulloblastoma, large-cell -2.900 6.1e-04
nephrosclerosis -1.099 2.9e-03
oligodendroglioma -2.400 2.7e-26
osteosarcoma 1.468 2.8e-05
ovarian cancer -1.200 1.1e-05
primitive neuroectodermal tumor -3.300 1.1e-05
psoriasis 1.600 7.3e-05

Gene RIF (2)

AA Sequence

MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPV      1 - 70
FSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTI     71 - 140
TIVAEEVSGTNDYVQLTFRAYKLDNKDLFSKSDPFMEIYKTNEDQSDQLVWRTEVVKNNLNPSWEPFRLS    141 - 210
LHSLCSCDVHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSG    211 - 280
TVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQD    281 - 350
YDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA    351 - 420
EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLR    421 - 490
CPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLATTPSPSP       491 - 557
//

Text Mined References (18)

PMID Year Title