Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.60
PubTator Score 16.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 2.1e-02
cutaneous lupus erythematosus 2.500 2.0e-03
ependymoma -1.800 1.5e-04
gastric cancer 1.100 1.4e-03
glioblastoma -1.400 1.1e-02
interstitial cystitis 1.600 9.2e-03
lung cancer -1.900 2.7e-03
medulloblastoma -1.700 4.1e-02
non-small cell lung cancer -1.768 5.9e-19
osteosarcoma -2.873 3.4e-05
primary Sjogren syndrome 2.200 5.1e-05
subependymal giant cell astrocytoma -5.341 3.1e-03

Gene RIF (10)

AA Sequence

MWWRVLSLLAWFPLQEASLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSK      1 - 70
YQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLM     71 - 140
CSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVA    141 - 210
PFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLG    211 - 280
LARKKSGILLLTLVSFLIFILFIIVQLFIMKLRKAHVIWKKENEVSEHTLESYRSRSNNEETSSEEKNGQ    281 - 350
SSHPMRCMNYITKLYSEAKTKRKENVQHSKLEEKHIQVPESIV                               351 - 393
//

Text Mined References (16)

PMID Year Title