Property Summary

NCBI Gene PubMed Count 30
Grant Count 14
R01 Count 8
Funding $974,513.3
PubMed Score 23.63
PubTator Score 25.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -2.262 0.000
acute quadriplegic myopathy 1.056 0.000
pancreatic ductal adenocarcinoma liver m... -1.374 0.002
ovarian cancer 1.100 0.002

Gene RIF (10)

PMID Text
25551675 support a role of Snap29 at key steps of membrane trafficking, and predict that signaling defects may contribute to the pathogenesis of cerebral dysgenesis
25419848 In mammalian cells, mutating the O-GlcNAc sites in SNAP-29, promotes the formation of a SNAP-29-containing SNARE complex, increases fusion between autophagosomes and endosomes/lysosomes, and promotes autophagic flux.
23231787 This work implicates SNAP29 as a major modifier of variable expressivity in 22q11.2 DS patients.
21073448 a causal relationship between defective function of SNAP29 and the pleiotropic manifestations of CEDNIK syndrome
20305790 SNAP29 mediated membrane fusion has an important role in endocytic recycling and consequently, in cell motility
19350501 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
15968592 a SNAP29 mutation codes for a SNARE protein involved in intracellular trafficking and causes a novel neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis, and palmoplantar keratoderma
15890653 SNAP-29 acts as a negative modulator for neurotransmitter release, probably by slowing recycling of the SNARE-based fusion machinery and synaptic vesicle turnover
11317222 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES      1 - 70
EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS     71 - 140
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS    141 - 210
MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL                          211 - 258
//

Text Mined References (34)

PMID Year Title
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25686250 2015 Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
25551675 2014 Multiple functions of the SNARE protein Snap29 in autophagy, endocytic, and exocytic trafficking during epithelial formation in Drosophila.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25419848 2014 O-GlcNAc-modification of SNAP-29 regulates autophagosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23231787 2013 Hemizygous mutations in SNAP29 unmask autosomal recessive conditions and contribute to atypical findings in patients with 22q11.2DS.
More...