Property Summary

NCBI Gene PubMed Count 32
PubMed Score 27.99
PubTator Score 25.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.056 7.8e-05
malignant mesothelioma 1.300 1.1e-06
osteosarcoma -1.034 5.3e-04
ovarian cancer 1.100 2.3e-03
pancreatic ductal adenocarcinoma liver m... -1.081 1.1e-03

Gene RIF (12)

AA Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES      1 - 70
EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS     71 - 140
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS    141 - 210
MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL                          211 - 258
//

Text Mined References (36)

PMID Year Title