Property Summary

NCBI Gene PubMed Count 37
Grant Count 41
R01 Count 21
Funding $4,371,448.28
PubMed Score 77.81
PubTator Score 61.09

Knowledge Summary

Patent (6,425)

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.700 0.016
inflammatory breast cancer -1.100 0.000

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (22)

PMID Text
26627478 analysis of Esrrb target genes indicates Esrrb may be an important factor in regulating cell proliferation
25805499 ERRbeta has a role in estrogen-dependent cellular function including cancer cell proliferation
25219474 The significant association and the presence of high-risk haplotypes identified in the ESRRB gene confirm the association of variants in ESRRB and rotator cuff disease.
25023176 study concludes ESRRB, a gene when mutated causes a form of hearing impairment, also contributes to dental decay likely by influencing the formation of an enamel surface more susceptible to demineralization under acidic conditions
24667650 ERRbeta signalling leads to BCAS2-mediated blockage of the G1/S transition and inhibition of the epithelial to mesenchymal transition through FST-mediated regulation of E-cadherin
22951369 This is the first report of DFNB35 mutations in the Czech Republic and it seems to be a rare cause of non-syndromic hearing loss.
21802533 A novel missense mutation in the ESRRB gene causes DFNB35 hearing loss in a Tunisian family.
21561608 Data confirm the up-regulation of ER-beta as the principal receptor involved in the progression of human endometriosis.
21177257 Parkin degrades ESRRA, ESRRB and ESRRG to limit the expression of MAOA and MAOB.
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT      1 - 70
PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP     71 - 140
ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT    141 - 210
KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW    211 - 280
MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA    281 - 350
NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP    351 - 420
MHKLFLEMLEAKVGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQI    421 - 490
SPSTRTPGGQGKHLWLTM                                                        491 - 508
//

Text Mined References (38)

PMID Year Title
26627478 2015 Messenger RNA profile analysis deciphers new Esrrb responsive genes in prostate cancer cells.
25805499 2015 Estrogen-related Receptor ? Reduces the Subnuclear Mobility of Estrogen Receptor ? and Suppresses Estrogen-dependent Cellular Function.
25729143 2015 Genome-wide association study identifies three novel genetic markers associated with elite endurance performance.
25219474 2015 Significant association of full-thickness rotator cuff tears and estrogen-related receptor-? (ESRRB).
25023176 2014 Role of estrogen related receptor beta (ESRRB) in DFN35B hearing impairment and dental decay.
24667650 2014 ERR? signalling through FST and BCAS2 inhibits cellular proliferation in breast cancer cells.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
22951369 2012 DFNB35 due to a novel mutation in the ESRRB gene in a Czech consanguineous family.
21802533 A novel missense mutation in the ESRRB gene causes DFNB35 hearing loss in a Tunisian family.
21561608 2011 Involvement of estrogen receptor-related receptors in human ovarian endometriosis.
More...