Property Summary

Ligand Count 7
NCBI Gene PubMed Count 41
PubMed Score 86.89
PubTator Score 61.09

Knowledge Summary

Patent (6,425)

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -1.100 7.7e-07
sonic hedgehog group medulloblastoma 1.700 1.6e-02

Gene RIF (25)

AA Sequence

MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT      1 - 70
PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP     71 - 140
ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT    141 - 210
KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW    211 - 280
MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA    281 - 350
NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP    351 - 420
MHKLFLEMLEAKV                                                             421 - 433
//

Text Mined References (42)

PMID Year Title