Property Summary

NCBI Gene PubMed Count 26
PubMed Score 342.17
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ 1.600 1.3e-04
invasive ductal carcinoma 1.300 4.5e-03
osteosarcoma -2.876 4.6e-07
pancreatic cancer -1.300 8.1e-03
primary pancreatic ductal adenocarcinoma -1.601 8.8e-03
tuberculosis 2.300 1.0e-07

Gene RIF (7)

AA Sequence

MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKR      1 - 70
IKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLE     71 - 140
DERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAP    141 - 210
APQPSSCSC                                                                 211 - 219
//

Text Mined References (28)

PMID Year Title