Property Summary

NCBI Gene PubMed Count 25
Grant Count 55
R01 Count 12
Funding $8,550,710.74
PubMed Score 314.07
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.876 0.000
primary pancreatic ductal adenocarcinoma -1.601 0.009
tuberculosis 2.300 0.000
ductal carcinoma in situ 1.600 0.000
invasive ductal carcinoma 1.300 0.005
pancreatic cancer -1.300 0.008

Gene RIF (6)

PMID Text
25823663 High expression of small GTPase Rab3D promotes cancer progression and metastasis.
23526941 The presence of Rab3D(N135I) decreases the restriction of maturing secretory granules (SGs) to the F-actin-rich cell cortex, blocks the removal of the endoprotease furin from SGs and impedes the processing of the luminal SG protein secretogranin II.
21702009 Our findings indicate that Rab3D regulates the exocytosis of many components critical for the maintenance of oral physiology.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20038531 MIST1 binds to highly conserved CATATG E-boxes to directly activate transcription of 6 genes, including those encoding the small GTPases RAB26 and RAB3D.
15257287 mutant Rab3D proteins interfere with the formation of bona fide Weibel-Palade bodies and consequently the acute, histamine-induced release of von-Willebrand factor

AA Sequence

MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKR      1 - 70
IKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLE     71 - 140
DERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAP    141 - 210
APQPSSCSC                                                                 211 - 219
//

Text Mined References (27)

PMID Year Title
25823663 2015 High expression of small GTPase Rab3D promotes cancer progression and metastasis.
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23526941 2013 Rab3D is critical for secretory granule maturation in PC12 cells.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
22899725 2012 A complete Rab screening reveals novel insights in Weibel-Palade body exocytosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21702009 2011 Changes in Rab3D expression and distribution in the acini of Sjögren's syndrome patients are associated with loss of cell polarity and secretory dysfunction.
21269460 2011 Initial characterization of the human central proteome.
21262767 2011 Tctex-1, a novel interaction partner of Rab3D, is required for osteoclastic bone resorption.
More...