Property Summary

NCBI Gene PubMed Count 70
PubMed Score 233.81
PubTator Score 86.76

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 3.38986818355051E-19
non-small cell lung cancer 2798 2.07043775110068E-13
posterior fossa group B ependymoma 1530 4.68826435956445E-13
lung cancer 4473 1.15386292081916E-6
urothelial carcinoma 318 1.30426447805513E-6
Duchenne muscular dystrophy 602 8.67575063707575E-6
primary pancreatic ductal adenocarcinoma 1271 5.54630209872973E-5
medulloblastoma, large-cell 6234 1.64954338040098E-4
pancreatic cancer 2300 3.41138437673566E-4
pilocytic astrocytoma 3086 4.19512505616741E-4
sonic hedgehog group medulloblastoma 1482 7.23194115415997E-4
limb girdle muscular dystrophy 2A 156 7.51848308287523E-4
atypical teratoid / rhabdoid tumor 4369 0.00147380362933044
invasive ductal carcinoma 2950 0.0014918962313223
cutaneous lupus erythematosus 1056 0.00248554973896014
astrocytic glioma 2241 0.00268441682778424
ovarian cancer 8492 0.00299779271308835
primitive neuroectodermal tumor 3031 0.00468847950357195
lung adenocarcinoma 2714 0.00488446220731399
ductal carcinoma in situ 1745 0.00536682908886899
oligodendroglioma 2849 0.00912380416563558
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0174054348864422
Down syndrome 548 0.0206615452350834
glioblastoma 5572 0.0225563312954303
Breast cancer 3099 0.0248609387717636
cystic fibrosis 1670 0.0257864404935098
nasopharyngeal carcinoma 1056 0.0337323163264911
gastric carcinoma 832 0.0383518377630772
interstitial lung disease 292 0.0389796494914495
adult high grade glioma 2148 0.0429683726158282
colon cancer 1475 0.0487289692711064



Accession O95715 B3KQU8 Q6UW97 Q86U69 Q9BTR1 Q9NS21
Symbols KEC




  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (54)

26428435 Data indicate that CXC chemokine CXCL14, CXC chemokine receptor CXCR7 and the ratio between CXC chemokine receptor CXCR4-2 and CXCR4-1 could predict diseae free survival in Ewing sarcoma patients.
25822025 Prometastatic effects of IRX1 were mediated by upregulation of CXCL14/NF-kappaB signaling.
25760073 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 essential CXCL12-operated functions of CXCR4 are insensitive to CXCL14
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
25102097 Data indicate that site-specific CpG methylation in the CXC chemokine CXCL14 promoter is associated with altered expression.
24938992 CXCL14 overexpression influences proliferation and changes in cell cycle distributions of HT29 colorectal carcinoma cells.
24710408 Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 14 (CXCL14) in primary human brain microvascular endothelial cells
24099668 CXCL14 inhibits colorectal cancer migration, invasion, and epithelial-to-mesenchymal transition (EMT) by suppressing NF-kappaB signaling.

AA Sequence

TTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE                                  71 - 111

Text Mined References (71)

PMID Year Title
26428435 2015 CXCL14, CXCR7 expression and CXCR4 splice variant ratio associate with survival and metastases in Ewing sarcoma patients.
25822025 2015 IRX1 hypomethylation promotes osteosarcoma metastasis via induction of CXCL14/NF-?B signaling.
25760073 2015 Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 2014 CXCL14 is no direct modulator of CXCR4.
25416956 2014 A proteome-scale map of the human interactome network.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
25102097 2014 Alterations to DNA methylation and expression of CXCL14 are associated with suboptimal birth outcomes.
24938992 2014 Expression and effect of CXCL14 in colorectal carcinoma.
24710408 2014 Cancer-associated fibroblasts expressing CXCL14 rely upon NOS1-derived nitric oxide signaling for their tumor-supporting properties.
24099668 2013 Epigenetic silencing of CXCL14 induced colorectal cancer migration and invasion.