Property Summary

NCBI Gene PubMed Count 70
Grant Count 28
R01 Count 14
Funding $3,740,885.82
PubMed Score 233.81
PubTator Score 86.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

PMID Text
26428435 Data indicate that CXC chemokine CXCL14, CXC chemokine receptor CXCR7 and the ratio between CXC chemokine receptor CXCR4-2 and CXCR4-1 could predict diseae free survival in Ewing sarcoma patients.
25822025 Prometastatic effects of IRX1 were mediated by upregulation of CXCL14/NF-kappaB signaling.
25760073 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 essential CXCL12-operated functions of CXCR4 are insensitive to CXCL14
25411967 three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients.
25102097 Data indicate that site-specific CpG methylation in the CXC chemokine CXCL14 promoter is associated with altered expression.
24938992 CXCL14 overexpression influences proliferation and changes in cell cycle distributions of HT29 colorectal carcinoma cells.
24710408 Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of chemokine (C-X-C motif) ligand 14 (CXCL14) in primary human brain microvascular endothelial cells
24099668 CXCL14 inhibits colorectal cancer migration, invasion, and epithelial-to-mesenchymal transition (EMT) by suppressing NF-kappaB signaling.
More...

AA Sequence

MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVII      1 - 70
TTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE                                  71 - 111
//

Text Mined References (71)

PMID Year Title
26428435 2015 CXCL14, CXCR7 expression and CXCR4 splice variant ratio associate with survival and metastases in Ewing sarcoma patients.
25822025 2015 IRX1 hypomethylation promotes osteosarcoma metastasis via induction of CXCL14/NF-?B signaling.
25760073 2015 Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25451233 2014 CXCL14 is no direct modulator of CXCR4.
25416956 2014 A proteome-scale map of the human interactome network.
25411967 2014 A systems genetics approach identifies CXCL14, ITGAX, and LPCAT2 as novel aggressive prostate cancer susceptibility genes.
25102097 2014 Alterations to DNA methylation and expression of CXCL14 are associated with suboptimal birth outcomes.
24938992 2014 Expression and effect of CXCL14 in colorectal carcinoma.
24710408 2014 Cancer-associated fibroblasts expressing CXCL14 rely upon NOS1-derived nitric oxide signaling for their tumor-supporting properties.
24099668 2013 Epigenetic silencing of CXCL14 induced colorectal cancer migration and invasion.
More...