Property Summary

NCBI Gene PubMed Count 15
PubMed Score 36.07
PubTator Score 31.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
ovarian cancer 8520 5.9e-05
Multiple myeloma 1332 4.9e-04
oligodendroglioma 2850 4.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.326 4.9e-04
oligodendroglioma -1.200 4.6e-02
ovarian cancer 2.000 5.9e-05

Gene RIF (3)

AA Sequence

MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK      1 - 70
KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII     71 - 140
SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK    141 - 210
KFKAKGTIDL                                                                211 - 220
//

Text Mined References (19)

PMID Year Title