Property Summary

Ligand Count 4
NCBI Gene PubMed Count 30
PubMed Score 57.37
PubTator Score 27.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.1e-06
ovarian cancer 8519 5.3e-05
osteosarcoma 7950 1.1e-04
group 3 medulloblastoma 4104 5.4e-03
subependymal giant cell astrocytoma 2287 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Schizophrenia 1160 3.57 1.8
Disease Target Count Z-score Confidence
Monocytic leukemia 1 3.556 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 5.4e-03
osteosarcoma -1.397 1.1e-04
ovarian cancer -1.400 5.3e-05
subependymal giant cell astrocytoma -1.082 4.5e-02
tuberculosis -1.700 1.1e-06

Synonym

Accession O95696 A6ZJA4
Symbols BRL
BRPF1
BRPF2

Gene

PDB

2L43   5GK9   2KU3   2LQ6   3LYI   3RCW   4Z02   5AME   5AMF   5FG6   5N49   5PNX   5PNY   5PNZ   5PO0   5PO1   5PO2   5PO3   5PO4   5PO5   5PO6   5PO7   5PO8   5PO9   5POA   5POB   5POC   5POD   5POE   5POF   5POG   5POH   5POI   5POJ   5POK   5POL   5POM   5PON   5POO   5POP   5POQ   5POR   5POS   5POT   5POU   5POV   5POW   5POX   5POY   5POZ   5PP0   5PP1   5PP2   5PP3   5PP4   5PP5   5PP6   5PP7   5PP8   5PP9   5PPA   5PPB   5PPC   5PPD   5PPE   5PPF   5PPG   5PPH   5PPI   5PPJ   5PPK   5PPL   5PPM   5PPN   5PPO   5PPP   5PPQ   5PPR   5PPS   5PPT   5PPU   5PPV   5PPW   5PPX   5PPY   5PPZ   5PQ0   5PQ1   5PQ2   5PQ3   5PQ4   5PQ5   5PQ6   5PQ7   5PQ8   5PQ9   5PQA   5PQB   5PQC   5PQD   5PQE   5PQF   5PQG   5PQH   5PQI   5PQJ   5PQK   5PQL   5PQM   5PQN   5PQO   5PQP   5PQQ   5PQR   5PQS   5PQT   5PQU   5PQV   5PQW   5PQX   5PQY   5PQZ   5PR0   5PR1   5PR2   5PR4   5PR5   5PR6   5PR7   5PR8   5PR9   5PRA   5PRB   5PRD   5PRE   5PRF   5PRG   5PRH   5PRI   5PRJ   5PRK   5PRL   5PRM   5PRO   5PRP   5PRQ   5PRR   5PRS   5PRT   5PRU   5PRV   5PRW   5PRX   5PRY   5PRZ   5PS0   5PS1   5PS2   5PS3   5PS4   5PS5   5PS6   5PS7   5PS8   5PS9   5PSA   5PSB   5PSC   5PSD   5PSE   5PSF   5PSG   5PSH   5PSI   5PSJ   5PSK   5PSL   5PSM   5PSN   5PSO   5PSP   5PSQ   5PSR   5PSS   5PST   5PSU   5PSV   5PSW   5PSX   5PSY   5PSZ   5PT0   5PT1   5PT2   5PT3   5PT4   5PT5   5PT6   5PT7   5PT8   5PT9   5PTA   5PTB   5PTC   5PTE   5PTF   5PTG   5PTH   5PTJ   5PTK   5PTL   5PTM   5PTN   5PTO   5PTQ   5PTR   5PTS   5PTT   5PTU   5PTV   5PTW   5PTX   5PTY   5PTZ   5PU0   5PU1   5PU2   5PU3   5PU4   5PU5   5PU6   5PU7   5PU8   5PU9   5PUA   5PUB   5PUC   5PUD   5PUE   5PUF   5PUG   5PUH   5PUI   5PUJ   5PUK   5PUL   5PUM   5PUN   5PUO   5PUP   5PUQ   5PUR   5PUS   5PUT   5PUU   5PUV   5PUW   5PUX   5PUY   5PUZ   5PV0   5PV1   5PV2   5PV3   5PV4   5PV5   5PV6   5PV7   5PV8   5PV9   5PVA   5PVB   5PVC   5PVD   5PVE   5PVF   5PVG   5PVH   5PVI   5PVJ   5PVK   5PVL   5PVM   5PVN   5PVO   5PVP   5PVQ   5PVR   5PVS   5PVT   5PVU   5PVV   5PVW   5PVX   5PVY   5PVZ   5PW0   5PW1   5PW2   5PW3   5PW4   5PW5   5PW6   5PW7   5PW8   5PW9   5PWA   5PWB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEM      1 - 70
SECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEPKVRIVEYSPPSAPRRPPVYY     71 - 140
KFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPAVSQSMFEFLMDRFEKESHCENQKQGEQQSL    141 - 210
IDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGA    211 - 280
FKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAF    281 - 350
HVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV    351 - 420
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYWLLKRLSRNGA    421 - 490
PLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIELLRKREKLKREQVKVEQVAM    491 - 560
ELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEED    561 - 630
FDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDV    631 - 700
DRLLDPANRAHLGLEEQLRELLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLE    701 - 770
GFEEDGAALGPEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL    771 - 840
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGNYAKAARIAAE    841 - 910
VGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQT    911 - 980
KSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEP    981 - 1050
TSDLSDID                                                                 1051 - 1058
//

Text Mined References (39)

PMID Year Title