Property Summary

NCBI Gene PubMed Count 26
PubMed Score 50.13
PubTator Score 27.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.397 0.000
group 3 medulloblastoma 1.300 0.005
tuberculosis -1.700 0.000
subependymal giant cell astrocytoma -1.082 0.045
ovarian cancer -1.400 0.000

Synonym

Accession O95696 A6ZJA4
Symbols BRL
BRPF1
BRPF2

Gene

PDB

2L43   2KU3   2LQ6   3LYI   3RCW   4Z02   5AME   5AMF   5FG6  

Gene RIF (9)

PMID Text
22820306 The PHD finger of BRPF2 can potentially bind DNA non-specifically with an evolutionarily conserved and positively charged surface.
21880731 Recognition of unmodified histone H3 by the first PHD finger of bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases monocytic leukemic zinc-finger protein (MOZ) and MOZ-related factor (MORF).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19908236 The association of BRD1 with schizophrenia in a Japanese population, was analysed.
19908236 Observational study of gene-disease association. (HuGE Navigator)
19763615 These results suggest a general role of BRD1 in the cell and stress that the two BRD1 variants may play different roles in the etiology of psychiatric disease.
19693800 BRD1 may have a role in schizophrenia and bipolar affective disorder
19693800 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of bromodomain containing 1 (BRD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEM      1 - 70
SECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEPKVRIVEYSPPSAPRRPPVYY     71 - 140
KFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPAVSQSMFEFLMDRFEKESHCENQKQGEQQSL    141 - 210
IDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGA    211 - 280
FKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAF    281 - 350
HVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV    351 - 420
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYWLLKRLSRNGA    421 - 490
PLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIELLRKREKLKREQVKVEQVAM    491 - 560
ELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEED    561 - 630
FDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDV    631 - 700
DRLLDPANRAHLGLEEQLRELLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLE    701 - 770
GFEEDGAALGPEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL    771 - 840
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGNYAKAARIAAE    841 - 910
VGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQT    911 - 980
KSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEP    981 - 1050
TSDLSDID                                                                 1051 - 1058
//

Text Mined References (33)

PMID Year Title
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24333487 2014 Molecular insights into the recognition of N-terminal histone modifications by the BRPF1 bromodomain.
24258712 2014 Bromodomain-PHD finger protein 1 is critical for leukemogenesis associated with MOZ-TIF2 fusion.
24065767 2013 Exchange of associated factors directs a switch in HBO1 acetyltransferase histone tail specificity.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22820306 2012 Solution structure of an atypical PHD finger in BRPF2 and its interaction with DNA.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
21880731 2011 Recognition of unmodified histone H3 by the first PHD finger of bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases monocytic leukemic zinc-finger protein (MOZ) and MOZ-related factor (MORF).
More...