Property Summary

NCBI Gene PubMed Count 31
PubMed Score 6.93
PubTator Score 15.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Crohn Disease 97
Disease Target Count P-value
non-small cell lung cancer 2798 2.03830621062329E-18
Breast cancer 3099 2.78720595363239E-8
posterior fossa group B ependymoma 1530 3.93791054673137E-8
lung adenocarcinoma 2714 5.86916582042708E-8
osteosarcoma 7933 8.29261766703663E-8
ovarian cancer 8492 2.97444764685792E-6
atypical teratoid / rhabdoid tumor 4369 1.267388169675E-5
glioblastoma 5572 2.08692417998459E-5
breast carcinoma 1614 1.61811742961824E-4
ductal carcinoma in situ 1745 5.93617113858188E-4
lung cancer 4473 7.41879751307698E-4
group 3 medulloblastoma 2254 8.88996349092384E-4
pediatric high grade glioma 2712 0.00102004751528604
cutaneous lupus erythematosus 1056 0.00219977960746652
invasive ductal carcinoma 2950 0.00655641869594587
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00741590260783294
primitive neuroectodermal tumor 3031 0.0120441990347467
subependymal giant cell astrocytoma 2287 0.0165387524957136
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Rheumatoid Arthritis 1171 0.0 1.0

Expression

Synonym

Accession O95684 A8K1D1 B2R705 Q49AI0 Q5R3F6 Q96EW1
Symbols FOP

Gene

PDB

2D68  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26905588 The rs151606 T>G was associated with an increased risk of lung cancer and rs12212247 T>C was associated with a decreased risk of lung cancer
23935994 This study was designed to determine the association of CCR6 and FGFR10P (tag)single nucleotide polymorphisms with Vogt-Koyanagi-Harada (VKH) syndrome, in two independent Chinese Han populations.
23554904 FOP is a centriolar satellite protein involved in ciliogenesis.
20526339 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
17888034 Since FGFR1OP is plays a significant role in lung cancer growth and progression, it may be useful as a prognostic biomarker and as a therapeutic target for lung cancer.
16690081 a 1.6A resolution crystal structure of the N-terminal dimerization domain of FOP. The structure comprises an alpha-helical bundle composed of two antiparallel chains, each of them having five alpha-helices.
16314388 CAP350 interacts directly with FOP (FGFR1 oncogene partner) to form a centrosomal complex required for microtubule anchoring.

AA Sequence

MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD      1 - 70
GRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEK     71 - 140
GPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSE    141 - 210
PKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSL    211 - 280
ASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEK    281 - 350
SEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA                         351 - 399
//

Text Mined References (40)

PMID Year Title
26905588 2016 Polymorphisms of the centrosomal gene (FGFR1OP) and lung cancer risk: a meta-analysis of 14,463 cases and 44,188 controls.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935994 2013 FGFR1OP tagSNP but not CCR6 polymorphisms are associated with Vogt-Koyanagi-Harada syndrome in Chinese Han.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23554904 2013 FOP is a centriolar satellite protein involved in ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...