Property Summary

NCBI Gene PubMed Count 34
PubMed Score 7.03
PubTator Score 15.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.3e-05
Breast cancer 1.100 2.8e-08
breast carcinoma 1.100 1.6e-04
cutaneous lupus erythematosus 1.300 2.2e-03
ductal carcinoma in situ 1.100 5.9e-04
ependymoma 1.100 9.9e-10
glioblastoma 1.100 2.1e-05
group 3 medulloblastoma 1.300 2.3e-03
intraductal papillary-mucinous neoplasm ... 1.300 7.4e-03
invasive ductal carcinoma 1.300 6.6e-03
lung adenocarcinoma 1.100 5.9e-08
lung cancer 1.100 1.1e-03
non-small cell lung cancer 1.061 7.9e-17
osteosarcoma -1.610 3.8e-03
ovarian cancer -1.400 3.0e-06
pediatric high grade glioma 1.100 1.0e-03
primitive neuroectodermal tumor 1.100 4.4e-03
subependymal giant cell astrocytoma 1.283 1.7e-02

Protein-protein Interaction (5)

Gene RIF (10)

AA Sequence

MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD      1 - 70
GRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEK     71 - 140
GPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSE    141 - 210
PKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSL    211 - 280
ASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEK    281 - 350
SEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA                         351 - 399
//

Text Mined References (43)

PMID Year Title