Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 5
Funding $3,643,956.33
PubMed Score 259.40
PubTator Score 32.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.043
ovarian cancer 1.100 0.000

Gene RIF (7)

PMID Text
25742793 CK5/6 have roles in biologically aggressive tumors likely to display resistance to trastuzumab ab initio in women diagnosed with HER2+ cancer
25347471 Analysis of teeth from individuals carrying the KRT75(A161T) variant revealed an altered enamel structure and a marked reduction of enamel hardness, suggesting that a functional keratin network is required for the mechanical stability of tooth enamel.
25063315 There were differences between CK5/6, p63,CK34betaE12 and TTF-1 expression with tumor differentiation in squamous cell carcinoma or adenocarcinomas
21427063 we observed a possible association between CK5/6 expression in the primary tumor and multiple versus solitary breast carcinoma brain metastasis
19614992 K75 expression is closely associated with the process of desquamation of the inner root sheath of hair follicles.
19366057 Positive staining for CK5/6 or CK17 was associated with a worse prognosis, high tumor grade and positive axillary lymph nodes.
18499686 Cytokeratin 5/6 can be a useful adjunct in cases with ductal hyperplasia but not in columnar cell lesions, on breast core biopsies

AA Sequence

MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSRSLYNLGGAKR      1 - 70
VSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGGIQEVTVNQSLLTPLHLQIDP     71 - 140
TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQ    141 - 210
LESITTERGRLEAELRNMQDVVEDFKVRYEDEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEE    211 - 280
INFIHSVFDAELSQLQTQVGDTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQ    281 - 350
VTAGRHGDDLRNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEAL    351 - 420
QKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLSSGYGSGSSIG    421 - 490
GGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH             491 - 551
//

Text Mined References (20)

PMID Year Title
25742793 2015 Cytokeratin 5/6 fingerprinting in HER2-positive tumors identifies a poor prognosis and trastuzumab-resistant basal-HER2 subtype of breast cancer.
25347471 2014 Hair keratin mutations in tooth enamel increase dental decay risk.
25063315 2014 Analysis of clinical characteristics and differential diagnosis of the lung biopsy specimens in 99 adenocarcinoma cases and 111 squamous cell carcinoma cases: utility of an immunohistochemical panel containing CK5/6, CK34?E12, p63, CK7 and TTF-1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21427063 2011 Breast carcinoma with brain metastases: clinical analysis and immunoprofile on tissue microarrays.
19614992 2010 Cytokeratin 75 expression in central, centrifugal, cicatricial alopecia--new observations in normal and diseased hair follicles.
19366057 Basal cytokeratin expression in relation to immunohistochemical and clinical characterization in breast cancer patients with triple negative phenotype.
18499686 2008 The role of cytokeratin 5/6 as an adjunct diagnostic tool in breast core needle biopsies.
18032949 2007 Expression of follicular sheath keratins in the normal nail with special reference to the morphological analysis of the distal nail unit.
More...