Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.33
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 6.8e-05
atypical teratoid / rhabdoid tumor -1.900 2.7e-09
ependymoma -1.100 6.9e-08
glioblastoma -1.100 2.6e-05
group 4 medulloblastoma -1.300 4.0e-05
intraductal papillary-mucinous neoplasm ... 1.600 3.0e-02
invasive ductal carcinoma -1.300 3.5e-03
medulloblastoma, large-cell -1.900 3.2e-07
Multiple myeloma 1.039 1.2e-02
osteosarcoma 1.315 9.1e-04
ovarian cancer -1.700 9.9e-11
pancreatic ductal adenocarcinoma liver m... -1.117 1.6e-02
Pilocytic astrocytoma -1.100 2.3e-05
primitive neuroectodermal tumor -1.100 1.8e-04
psoriasis -1.900 5.5e-04
subependymal giant cell astrocytoma -1.205 2.4e-02

Gene RIF (5)

AA Sequence

MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWW      1 - 70
VRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFF     71 - 140
YGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQ    141 - 210
SHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYV    211 - 280
MSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIG    281 - 350
PFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQ    351 - 420
QLHIFNTLRSHLIDKGMLTSTTEDE                                                 421 - 445
//

Text Mined References (25)

PMID Year Title